Recombinant Human Peptidyl-Trna Hydrolase Ict1, Mitochondrial (MRPL58) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09937P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Peptidyl-Trna Hydrolase Ict1, Mitochondrial (MRPL58) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09937P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Peptidyl-Trna Hydrolase Ict1, Mitochondrial (MRPL58) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q14197 |
| Target Symbol | MRPL58 |
| Synonyms | Digestion substraction 1; DS-1; DS1; Ict1; ICT1_HUMAN; Immature colon carcinoma transcript 1; Immature colon carcinoma transcript 1 protein; mitochondrial; Peptidyl-tRNA hydrolase ICT1; Peptidyl-tRNA hydrolase ICT1, mitochondrial |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD |
| Expression Range | 30-206aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 36.4kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes. |
| Subcellular Location | Mitochondrion. |
| Protein Families | Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily |
| Database References | HGNC: 5359 OMIM: 603000 KEGG: hsa:3396 STRING: 9606.ENSP00000301585 UniGene: PMID: 29328466 |
