Recombinant Human Peptidyl-Trna Hydrolase Ict1, Mitochondrial (MRPL58) Protein (His-SUMO)

Name: Recombinant Human Peptidyl-Trna Hydrolase Ict1, Mitochondrial (MRPL58) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09937P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Peptidyl-Trna Hydrolase Ict1, Mitochondrial (MRPL58) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q14197
Target Symbol	MRPL58
Synonyms	Digestion substraction 1; DS-1; DS1; Ict1; ICT1_HUMAN; Immature colon carcinoma transcript 1; Immature colon carcinoma transcript 1 protein; mitochondrial; Peptidyl-tRNA hydrolase ICT1; Peptidyl-tRNA hydrolase ICT1, mitochondrial
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Expression Range	30-206aa
Protein Length	Full Length of Mature Protein
Mol. Weight	36.4kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
Subcellular Location	Mitochondrion.
Protein Families	Prokaryotic/mitochondrial release factor family, Mitochondrion-specific ribosomal protein mL62 subfamily
Database References	HGNC: 5359 OMIM: 603000 KEGG: hsa:3396 STRING: 9606.ENSP00000301585 UniGene: Hs.407955
Tissue Specificity	Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells.

Gene Functions References

High ICT1 expression is associated with leukemia. PMID: 29328466
ICT1 overexpression notably predicted poor prognosis of gastric cancer patients. PMID: 28987942
Study demonstrates that ICT1 overexpression correlates with malignant clinical features and poor prognosis of hepatocellular carcinoma (HCC) patients. Functionally, ICT1 promotes proliferation, cell cycle progression and inhibits apoptosis of HCC cells. ICT1 regulates the expressions of CDK1, cyclin B1, Bcl-2 and Bax, and is directly targeted by microRNA-134 (miR-134) in HCC cells. PMID: 29130100
ICT1 may play a crucial role in promoting gastric cancer proliferation in vitro. PMID: 29036264
The results provide direct evidence that localized feedbacks on Fat4-Ds1 complexes can give rise to planar cell polarity. PMID: 28826487
our preliminary study reveals the important role of ICT1 in NSCLC cells that knockdown of ICT1 significantly suppressed cell proliferation, arrested cell cycle though altering expression cell cycle regulators, and promoted cell apoptosis. PMID: 27413166
ICT1 knockdown significantly inhibited cell proliferation and migration, led to G2/M phase cell-cycle arrest, and triggered apoptosis via the intracellular AMPKa, SAPK/JNK, and PARP signaling pathways. PMID: 27411551
ICT1 was significantly upregulated in diffuse large B-cell lymphoma tissues (DLBCL) and correlated with poor survival. Knockdown of ICT1 remarkably induced cell cycle G0/G phase arrest and apoptosis in DLBCL cells. PMID: 28629825
ICT1 knockdown altered the expression of apoptosis- or cell cyclerelated proteins such as Bcl-2, caspase-3, CDK1, CDK2 and cyclin B. PMID: 28290601
ICT1 may be essential for hydrolysis of prematurely terminated peptidyl-tRNA moieties in stalled mitoribosomes. PMID: 20186120

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.