Recombinant Human Pcna-Associated Factor (PCLAF) Protein (GST)

Name: Recombinant Human Pcna-Associated Factor (PCLAF) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-04489P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Pcna-Associated Factor (PCLAF) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q15004
Target Symbol	PCLAF
Synonyms	HCV NS5A transactivated protein 9 ; HCV NS5A-transactivated protein 9; Hepatitis C virus NS5A transactivated protein 9; Hepatitis C virus NS5A-transactivated protein 9; KIAA0101; L5; NS5 ATP9; NS5ATP9; OEATC 1; OEATC; OEATC-1; OEATC1; Overexpressed in anaplastic thyroid carcinoma 1; p15(PAF); p15PAF; PAF; PAF_HUMAN; PCNA associated factor; PCNA-associated factor
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Expression Range	1-111aa
Protein Length	Full Length
Mol. Weight	39.0kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Subcellular Location	Nucleus. Cytoplasm, perinuclear region. Note=Following DNA damage, localizes to DNA damage sites (PubMed:21628590). Colocalizes with centrosomes in perinuclear region (PubMed:21673012).
Database References	HGNC: 28961 OMIM: 610696 KEGG: hsa:9768 STRING: 9606.ENSP00000300035 UniGene: PMID: 29902451 PAF supports glioma stem cells maintenance, in part, by influencing DNA replication and pyrimidine metabolism pathways.PAF-associated DNA translesion synthesis activity influences glioma stem cell radiation resistance. PMID: 29073105 KIAA0101 tv2 exerts anti-tumor activity in HCC and acts as an endogenous competitor of tumor-associated KIAA0101 tv1. KIAA0101 tv2 has a potential to work as a therapeutic drug targeting the KIAA0101 tv1 in HCC. PMID: 28410205 Paf15 expression is associated with increased rectal cancer proliferation, decreased patient survival, and a worse radiotherapeutic response PMID: 27246972 High KIAA0101 expression is associated with kidney cancer. PMID: 26575329 The complex between p15PAF and trimeric PCNA is of low affinity, forming a transient complex that is difficult to characterize at a structural level due to its inherent polydispersity. We have determined the structure, conformational fluctuations, and relative population of the five species that coexist in solution by combining small-angle X-ray scattering (SAXS) with molecular modelling. PMID: 28180305 miR-429 mediates deregulation of KIAA0101 by acting as an anti-metastatic miRNA that targets KIAA0101 pro-metastatic gene during metastasis of soft tissue sarcomas PMID: 28432002 PAF stimulation dose-dependently promoted the invasion, migration and growth of prostate cancer cells in vitro, while knockdow our findings demonstrate that PAFR can activate ERK1/2 pathway, and subsequently increase MMP-3 expression and decrease E-cadherin expression PMID: 27176648 High KIAA0101 level is associated with metastasis in hepatocellular carcinoma. PMID: 26968109 Results unveil an unsuspected role of the PAF-Wnt signalling axis in modulating cell plasticity, which is required for the maintenance of breast cancer cell stemness. PMID: 26843124 IN PATIENTS WITH HEPATITIS C VIRUS GENOTYPE 1B, TREATMENT RESPONSE WITH DACLATASVIR PLUS ASUNAPREVIR WITHOUT NS5A-L31F/I/M/V and/or NS5A-Y93H polymorphisms PMID: 26155891 p15PAF acts as a flexible drag that regulates PCNA sliding along the DNA and facilitates the switch from replicative to translesion synthesis polymerase binding. PMID: 25762514 Data show that hepatitis C virus NS5A-transactivated protein 9 (NS5ATP9) knockdown activated mitogen-activated protein kinase kinase/extracellular signal regulated kinases 1/2 signaling under C virus nonstructural protein 5A (NS5A) expression. PMID: 23698777 NS5ATP9 mRNA overexpression in peripheral blood mononuclear cells was significantly associated with poor disease-free survival and overall survival of gastric cancer patients, but not with tumor recurrence. PMID: 24996800 These results highlight an important potential role for NS5ATP9 in hepatitis C virus NS5A-induced hepatocyte autophagy. PMID: 24750205 overexpression of KIAA0101 mRNA in peripheral blood mononuclear cells could act as a predictive biomarker for hepatic cancer PMID: 24197986 Upregulated expression of KIAA0101 is associated with esophageal cancer progression, resistance to chemotherapy, and poor survival. PMID: 24145239 Data indicate that PAF-EZH2-beta-catenin complex hyperactivates Wnt signaling. PMID: 24055345 p15(PAF) is tightly regulated by the Rb/E2F complex. Loss of Rb/E2F-mediated repression during the G1/S transition phase leads to p15(PAF) upregulation, which facilitates DNA synthesis and S-phase progression. PMID: 23593430 Low expression of PAF and high expression of TNF-alpha in leukocytospermia affect the sperm motility, which is one of the reasons that leads to infertility. PMID: 23209346 GC patients with elevated KIAA0101 expression levels exhibited a high recurrence and subsequently poor prognosis in the survival study PMID: 23240630 Down-regulation of KIAA0101 expression leads to an inhibition of cell proliferation, cell cycle and cell invasion of gastric carcinoma. PMID: 23157749 KIAA0101 transcript variant 1 may function as a regulator, promoting cell survival in hepatocellular carcinoma through regulating the function of p53. PMID: 22576474 The results uncovered a critical role for PCNA-associated factor PAF15 (p15(PAF)/KIAA0101) ubiquitylation during DNA replication. During unperturbed S phase, chromatin-associated PAF15 is modified by double mono-ubiquitylation of lysine 15 and 24. PMID: 23000965 High-level KIAA0101 expression was observed in 33.9% (121 of 357 cases). PMID: 21689861 Data supports that KIAA0101 is a marker of cellular proliferation, promotes growth and invasion, and is a good diagnostic marker for distinguishing benign from malignant adrenocortical neoplasm. PMID: 22096502 This study identifies KIAA0101 as a protein important for breast tumorigenesis, and as this factor has been reported as a UV repair factor, it may link the UV damage response to centrosome control PMID: 21673012 Data indicate that PAF15 associates with PCNA, and depletion of PAF15 decreases the number of cells in S phase, suggesting a role for it in cell cycle regulation. PMID: 21628590 KIAA0101 gene may participate in cell cycle regulation of non-small cell lung cancer. PMID: 20118010 Overexpression of KIAA0101 is associated with anaplastic thyroid carcinoma PMID: 15789362 KIAA0101 protein expression was down-regulated in hepatocellular carcinoma; this gene could inhibit the HCC cell growth in vitro and presumably by its blocking effect on cell cycle PMID: 16646990 NS5ATP9 is a NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma. PMID: 18068894 p15(PAF) gene is regulated by NF-kappa B signal transduction. PMID: 18727915 Interaction between p15(PAF)and Proliferating Cell Nuclear Antigen is required for the DNA repair process. PMID: 19219066 The PCNA-associated factor KIAA0101/p15(PAF) binds the potential tumor suppressor product p33ING1b. PMID: 16288740

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.