Recombinant Human Parathyroid Hormone-Related Protein (PTHLH) Protein (His)

Beta LifeScience SKU/CAT #: BLC-04366P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Parathyroid Hormone-Related Protein (PTHLH) Protein (His)

Beta LifeScience SKU/CAT #: BLC-04366P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Parathyroid Hormone-Related Protein (PTHLH) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P12272
Target Symbol PTHLH
Synonyms HHM; MGC14611; Osteostatin; Parathyroid hormon like hormone isoform 2 preproprotein; Parathyroid hormone like hormone; Parathyroid hormone like hormone isoform 1 preproprotein; Parathyroid hormone like protein; Parathyroid hormone like related protein; Parathyroid hormone related protein; Parathyroid hormone-like protein; Parathyroid like protein; PLP; PTH related protein; PTH-rP; PTHLH; PTHR; PTHR_HUMAN; PTHrP; PTHrP[107-139]
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
Expression Range 37-175aa
Protein Length partial
Mol. Weight 19.7kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath. Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.; Osteostatin is a potent inhibitor of osteoclastic bone resorption.
Subcellular Location Cytoplasm. Nucleus. Secreted.
Protein Families Parathyroid hormone family
Database References

HGNC: 9607

OMIM: 168470

KEGG: hsa:5744

STRING: 9606.ENSP00000379213

UniGene: PMID: 28120940

  • Our study thus demonstrates the dual roles of PTHrP on TGF-b1 signaling and FN up-regulation for the first time in glomerular mesangial cells . These data also provided new insights to guide development of therapy for diabetic kidney disease PMID: 28954822
  • these data suggest that PTHrP(12-48) is a bioactive breast cancer-derived peptide that locally regulates the differentiation of hematopoietic cells and the activity of osteoclasts within the tumor-bone marrow microenvironment, perhaps to facilitate tumor control of bone. PMID: 28370412
  • RSK activation via ERK modulates human colon cancer cells response to PTHrP. PMID: 28385776
  • this is the first time that mutation recurrence has been detected in PTHLH associated with brachydactyly type E and we have observed that, as remarked before, this syndrome has high intrafamilial as well as interfamilial variability PMID: 28211986
  • Antagonistic antibodies against the death receptors demonstrated that Apo2L/TRAIL mediated its apoptotic signals through activation of the TRAIL-R2 in PTHrP expressing breast cancer cells PMID: 23822995
  • Amino PTHrP and carboxyl PTHrP can vary independently in different lung carcinomas. Carboxyl PTHrP may temper the stimulatory effect of amino PTHrP on cancer progression. PMID: 28342003
  • PTHLH is a gastrin-regulated growth factor that might contribute to gastric epithelial cell homeostasis. PMID: 28408643
  • Duplication of PTHLH co-segregates with osteochondroplasia with a combined brachydactyly type E/A1 in a three-generation pedigree. PMID: 26733284
  • Data shown here expand the knowledge on the phenotypic presentation of PTHLH mutations, highlighting significant clinical variability and incomplete penetrance of the PTHLH-related symptoms. PMID: 26763883
  • We showed that the supplementation of the osteogenic differentiation medium with PTHrP inhibited the alkaline phosphatase activity and the expression of the transcription factor DLX3, but the depletion of PTHrP did not support the differentiation of DFCs.We showed that SUFU (Suppressor Of Fused Homolog) was not regulated during the osteogenic differentiation in DFCs PMID: 27368119
  • High expression of PTHRP is associated with Tongue squamous cell carcinoma. PMID: 27316348
  • No relationship between plasma PTHrP levels and failure of tooth eruption, dental manifestations of pseudohypoparathyroidism or brachydactyly was found. PMID: 26855372
  • we report three patients affected with brachydactyly type E, caused by PTHLH mutations expected to result in haploinsufficiency, and discuss our data compared to published reports. PMID: 26640227
  • TGF-beta and PTHrP were confirmed to be involved in regulating the malignant progression in breast cancer, and PTHrP expression, to be associated with bone metastasis as a potential prognostic marker in ER negative breast cancer PMID: 26597083
  • Data suggest affinity of ligands for binding site on PTH1R/parathyroid hormone 1 receptor, either in GTP-binding protein-dependent or -independent conformation, alters duration of action of ligand in target cells; ligands were peptide fragments of PTHRP. PMID: 26562265
  • A novel heterozygous mutation in PTHLH gene was identified in a Chinese pedigree with brachydactyly type E. PMID: 25801215
  • PTHLH/PTHrP could play a role in the pathogenesis of oral squamous cell carcinoma by affecting cell proliferation and cell cycle. PMID: 25539663
  • PTHrP regulates Caco-2 cell proliferation via several signaling pathways. PMID: 25053227
  • Intermittent application of PTHrP represents an important novel means to improve chondrogenesis of MSCs and may be considered as a supporting clinical-treatment mode for MSC-based cartilage defect regeneration PMID: 24836507
  • Data show three individuals with duplications of the parathyroid hormone-like hormone (PTHLH) locus leading to a hitherto unrecognized syndrome characterized by acro-osteolysis, cortical irregularity of long bones and metadiaphyseal enchondromata. PMID: 25007883
  • PTHrP positively modulates cell cycle progression and changes the expression of proteins involved in cell cycle regulation. PMID: 25051885
  • miR-126-5p could directly target PTHrP and have a tumor suppressor function in giant cell tumor. PMID: 24973691
  • High PTHLH expression is strongly associated with poor outcome both in overall survival and disease-free survival for patients who underwent standard nephrectomy. PMID: 24861371
  • High PTHRP expression is associated with bone destruction in lung and breast cancer. PMID: 25359619
  • Threonine at position 107 contributes to the osteogenic actions of PTHrP in osteoblasts. PMID: 24725082
  • High PTHRP expression is associated with metastasis in breast cancer. PMID: 25368276
  • PTHLH is important during embryonic development. [review] PMID: 25252304
  • Data suggest that parathyroid hormone-related protein (PTHrP) may work through epithelial-to-mesenchymal transition (EMT) to promote an aggressive and metastatic phenotype in prostate cancer. PMID: 24465715
  • PTHrP mediates energy wasting in fat tissues and contributes to the broader aspects of cancer cachexia; thus, neutralization of PTHrP might hold promise for ameliorating cancer cachexia and improving patient survival PMID: 25043053
  • It is a critical physiological regulator of various biological processes, including bone and cartilage metabolism. (review) PMID: 24870837
  • PTHrP was found to inhibit DKK1 expression through c-Jun-mediated inhibition of beta-catenin activity on the DKK1 promoter. PMID: 23752183
  • Evaluation of clinical breast tumor samples revealed that reduced DLC1 expression was linked to elevated PTHLH expression and organ-specific metastasis to bone. PMID: 24590291
  • High PTHRP mRNA expression correlated with lung cancer stage, presence of bone metastasis, and squamous cell carcinoma. PMID: 23810363
  • PTHrP expression in human MDA-MB-231 breast cancer cells is critical for tumor growth and survival and osteoblast inhibition. PMID: 23983616
  • PTHrP intracellular retention is down-regulated in osteo-differentiating cells whereas the secretion of the protein in the extracellular medium is up-regulated with respect to stem cells. PMID: 23810909
  • these results evidence a protective effect of PTHrP under apoptotic conditions in intestinal cells. PMID: 23845990
  • Data indicate that expressions of PTHrP, EPO, and VEGF were respectively related to advanced stage of clear cell renal cell carcinoma (ccRCC). PMID: 23780896
  • Prostate cancer-derived PTHrP acts in the bone marrow to potentiate CD11b(+)Gr1(+) cells, which are recruited to tumor tissue where they contribute to tumor angiogenesis and growth. PMID: 24072746
  • PTHrP excreted by giant cell tumor of bone stromal cells increases bone tumor cell local invasiveness and migration. PMID: 23466453
  • new clues to understand the underlying mechanisms whereby PTHrP can increase bone formation. PMID: 23494914
  • PTHrP is highly detectable in intermediate and epidermoid cells, and abundant expression of PTHrP in intermediate cells has a significant association with cancer malignancy. PMID: 23588777
  • All 3 markers were studied independently and were associated with tumor percentage in metastatic lymph nodes. PVA had the strongest correlation, followed by PTHrP and then TACSTD1. PMID: 23625795
  • Parathyroid hormone-related protein is induced by hypoxia and promotes expression of the differentiated phenotype of human articular chondrocytes. PMID: 23662774
  • findings represent the initial genetic evidence that PTHrP regulates periosteal/intramembranous bone cell activity on cortical bone surfaces and indicate that PTHrP serves as a load-induced modeling tool in fibrous insertion sites during linear growth PMID: 23109045
  • that miR-33a may be a potent tumor suppressor, which inhibits direct and indirect osteoclastogenesis through repression of PTHrP. PMID: 23458685
  • PTHrP increases the promoter activity of the integrin alpha6 and beta4 subunits. PMID: 23499737
  • Tristetraproline (TTP) is an RNA-binding protein that may be involved in ARE-mediated degradation of parathyroid hormone-related protein. PMID: 22960231
  • activated PTHLH coupling feedback phosphoinositide to G-protein receptor signal-induced cell adhesion network in hepatocellular carcinoma PMID: 22997493
  • systems theory analysis of PTHLH downstream leukocyte adhesion-mediated protein amino acid N-linked glycosylation coupling Notch and JAK-STAT cascade to iron-sulfur cluster assembly-induced aging network in no-tumor hepatitis/cirrhotic tissues PMID: 22955522

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed