Recombinant Human Parathyroid Hormone (PTH), Active
Beta LifeScience
SKU/CAT #: BLC-05602P

Greater than 95% as determined by SDS-PAGE.
Recombinant Human Parathyroid Hormone (PTH), Active
Beta LifeScience
SKU/CAT #: BLC-05602P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Parathyroid Hormone (PTH), Active is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to induce cAMP accumulation in MC3T3-E1 mouse preosteoblast cells is less than 0.1 ug/ml |
Uniprotkb | P01270 |
Target Symbol | PTH |
Synonyms | hPTH; Parathormone; Parathyrin; Parathyroid hormone 1; Parathyroid hormone; Prepro PTH; Preproparathyroid hormone; PTH; PTH1; PTH1 receptor; PTH1R; PTHR; PTHR1; PTHY_HUMAN |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | Tag-Free |
Complete Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Expression Range | 32-115aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 9 kDa |
Research Area | Signal Transduction |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. |
Subcellular Location | Secreted. |
Protein Families | Parathyroid hormone family |
Database References | HGNC: 9606 OMIM: 146200 KEGG: hsa:5741 STRING: 9606.ENSP00000282091 UniGene: PMID: 29348466 |