Recombinant Human Parathyroid Hormone (PTH), Active

Beta LifeScience SKU/CAT #: BLC-05602P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Parathyroid Hormone (PTH), Active

Beta LifeScience SKU/CAT #: BLC-05602P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Parathyroid Hormone (PTH), Active is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to induce cAMP accumulation in MC3T3-E1 mouse preosteoblast cells is less than 0.1 ug/ml
Uniprotkb P01270
Target Symbol PTH
Synonyms hPTH; Parathormone; Parathyrin; Parathyroid hormone 1; Parathyroid hormone; Prepro PTH; Preproparathyroid hormone; PTH; PTH1; PTH1 receptor; PTH1R; PTHR; PTHR1; PTHY_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag Tag-Free
Complete Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Expression Range 32-115aa
Protein Length Full Length of Mature Protein
Mol. Weight 9 kDa
Research Area Signal Transduction
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Subcellular Location Secreted.
Protein Families Parathyroid hormone family
Database References

HGNC: 9606

OMIM: 146200

KEGG: hsa:5741

STRING: 9606.ENSP00000282091

UniGene: PMID: 29348466

  • Data suggest that, in pregnant women with largely sufficient calcium intakes (via diet and dietary supplements), serum 25-hydroxyvitamin D (total of 25[OH]D2 and 25[OH]D3) is important for maintaining normal serum PTH levels; this study was conducted in group of white-skinned women at northern latitudes in Ireland. PMID: 30018262
  • In conclusion, Fetuin A, vitamin D, and intact PTH levels were all associated with sarcopenia in this geriatric population. Among them, intact PTH specifically indicates patients with sarcopenic left ventricular hypertrophy. PMID: 28112206
  • Dkk-1 and PTH levels in psoriatic arthritis are lower than healthy female controls, in contrast with rheumatoid arthritis, in which they are increased PMID: 28634697
  • Scientific evidence of genetic association of serum PTH level among individuals with different pathologic conditions remains deficient and published results provide weak evidence (review and meta-analysis). PMID: 29794776
  • Clinical data on secondary hyperparathyroidism, mainly derived from patients with chronic kidney disease, indicate a potential inverse association between leptin (LEP) and parathyroid hormone (PTH) in some, but not all studies. [REVIEW] PMID: 28730419
  • Parathyroid hormone controls bone and kidney homeostasis via GNAS and Gq-G11 heterotrimeric G proteins. (Review) PMID: 28363951
  • Patients with chronic kidney disease undergoing parathyroidectomy for primary hyperparathyroidism have similar intraoperative parathyroid hormone degradation kinetics to those with normal kidney function. PMID: 29128188
  • PTH levels are significantly higher in untreated sustained hypertension patients than white-coat hypertension patients and normotensive subjects. PMID: 29176783
  • results revealed that PTH treatment on HCs, either continuous or pulsatile, does not exhibit any positive effect, and indicates that exogenous PTH administration after fracture has no effect on HCs. PTH may not have a positive effect at the fracture site during the early stage of fracture healing in which haematoma formation occurs. PMID: 24039091
  • Pre-incubation of muscle fibers or myotubes with physiological concentrations of PTH, concentration-dependently reduced uptake of labelled 25-hydroxyvitamin D3. PMID: 28104493
  • Baseline PTH level was not associated with changes in frailty status in men. PMID: 28609827
  • Elevated PTH induces the transition of endothelial cells to chondrogenic cells via endothelial-mesenchymal transition, possibly mediated by the nuclear translocation of beta-catenin. PMID: 27582099
  • Cys mutation at the 25th residue of hPTH(1-34) may result in a high bone mass phenotype. PMID: 27300576
  • Common genetic variants located near genes involved in vitamin D metabolism and calcium and renal phosphate transport associated with differences in circulating parathyroid hormone concentrations PMID: 27927781
  • PTH pretreatment prevented TGF-beta1 and high glucose-induced Smad2/3 phosphorylation and consequent upregulation of fibronectin and type IV collagen within 4 h. PMID: 27530924
  • FGFR1c and PTHR signaling pathways converge on NHERF1 to inhibit PTH- and FGF23-sensitive phosphate transport and down-regulate NPT2A. PMID: 27432882
  • The present study supports the independent pathogenic effect of rs6254GA polymorphism on the development and severity of bone mineral density complications in patients with asymptomatic but not normocalcemic hyperparathyroidism. PMID: 27756092
  • In patients receiving dual antiplatelet therapy for coronary artery disease, higher PTH levels are associated with an increased ADP-mediated platelet reactivity and suboptimal response to clopidogrel. PMID: 27086085
  • Parathyroid hormone gene rs6256 variants are not associated with susceptibility to colorectal cancer PMID: 25124570
  • PTH levels were significantly higher in patients with aldosterone producing adenomas. PMID: 26304960
  • Although there was a trend for a negative association in women, no statistically significant association was found between endogenous PTH and knee osteoarthritis. PMID: 25879737
  • The purpose of this study was to investigate the prevalence of adenomatous colon polyps (ACP) as they occur in subjects with diabetes mellitus (DM) and chronic kidney disease. PMID: 27993873
  • PTH [parathyroid hormone]together with other markers of heart failure may provide valuable information both in the diagnosis and staging of heart failure syndromes PMID: 27546695
  • Patients with a serum PTH decrease to low values after 1 year of hemodialysis treatment are at high risk of short-term cardiovascular death. PMID: 26880460
  • a cell model of human dermal fibroblasts in order to investigate the functions of sclerostin, is reported. PMID: 26851122
  • recombinant human klotho inhibits the expression of 1-OH by PTH both in vitro and in vivo. PMID: 26287968
  • results suggest that NO-mediated vasorelaxation plays partly a role in the anabolic action of PTH on cortical bone PMID: 26834008
  • In this large community-based cohort, PTH levels, overall, were not independently associated with the risk of hypertension. However, we found some evidence that PTH may be associated with hypertension in blacks. PMID: 26867053
  • The objective of this article is to investigate the effect of renin-angiotensin system inhibitors (RASIs) on intact parathyroid hormone (iPTH) levels in continuous ambulatory peritoneal dialysis (CAPD) patients. PMID: 25271253
  • PTH does not contribute to the occurrence of metabolic components of obesity, but there is a positive correlation between 25(OH)D and HDL-C. PMID: 26451492
  • Data suggest that effects of PTH on bone remodeling are mediated not only by osteoblasts/osteocytes but also by T-lymphocytes in bone marrow; T-lymphocytes regulate differentiation/life span of stromal cells and their responsiveness to PTH. [REVIEW] PMID: 26662934
  • Serum secreted i-PTH level might not be predictable by a total mass of parathyroid glands or by their blood supply. PMID: 26997379
  • A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism. PMID: 25891861
  • Study indicates significant association between specific PTH gene promoter region variants and altered levels of 25(OH)D and vitamin D deficiency among specific nationals. PMID: 26339419
  • Elevation of PTH, unlike vitamin D, is independently associated with Chronic Obstructive Pulmonary Disease (COPD) severity, and may be a better biomarker for COPD. PMID: 26398210
  • Abnormal diurnal patterns of PTH are associated with sustained mild hypercalcemia in nondialyzed chronic kidney disease patients. PMID: 27012036
  • These data indicate that ephrinB2/EphB4 signaling within the osteoblast lineage is required for late stages of osteoblast differentiation. PMID: 23165727
  • Serum 25(OH)D levels were inversely associated with serum PTH and bone mineral density. PMID: 23045165
  • Elevated parathyroid hormone serum concentrations might have a role in colorectal cancer development as indicated by higher rates of adenomas, specifically with dysplasia, in women. PMID: 26021763
  • the iPTH level in ESRD patients carrying VDR BsmI Bb genotype was higher than that in ESRD patients carrying bb genotype in overall populations and in Caucasians PMID: 25007156
  • The identification of PTH and other hormonal resistances implies to look for the genetic disorder supporting the metabolic disorder--{REVIEW} PMID: 25913526
  • Intraoperative PTH monitoring during parathyroidectomy to determine PTH clearance proved to be a feasible marker for adequacy and safety of surgery and "cure". PMID: 25241609
  • Data suggest serum PTH level is independently associated with bone mineral density (BMD) in vitamin D-sufficient women and vitamin D-insufficient women; no association was found in men; high serum PTH is detrimental on BMD in postmenopausal women. PMID: 25242259
  • In a racially/ethnically diverse population without prevalent cardiovascular disease, higher serum PTH concentration was associated with increased left ventricular mass and increased risk of incident heart failure. PMID: 25468653
  • In a large community-based sample of elderly, calcium was independently associated with increased arterial stiffness, and PTH independently to intra-arterial peripheral and calculated central blood pressures. PMID: 25562577
  • Suggest that measurement of iPTH may be useful for assessment of mineral bone disorder in patients with chronic kidney disease. PMID: 26299086
  • A detailed characterization of in vitro generated amyloid fibrils from human parathyroid hormone (hPTH(1-84)). PMID: 25554227
  • salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity. PMID: 25218037
  • A panel of easily assessable determinants could account for both a substantial proportion of PTH variance and the occurrence of secondary hyperparathyroidism. PMID: 24202062
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed