Recombinant Human Papillomavirus Type 11 Protein E4 (E4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01931P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Papillomavirus Type 11 Protein E4 (E4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01931P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Papillomavirus Type 11 Protein E4 (E4) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P04016 |
| Target Symbol | E4 |
| Species | Human papillomavirus type 11 |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MADDSALYEKYPLLNLLHTPPHRPPPLQCPPAPRKTACRRRLGSEHVDRPLTTPCVWPTSDPWTVQSTTSSLTITTSTKEGTTVTVQLRL |
| Expression Range | 1-90aa |
| Protein Length | Full Length |
| Mol. Weight | 17.5 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions. |
| Subcellular Location | Host cytoplasm. Host nucleus. |
| Protein Families | Papillomaviridae E4 protein family |
