Recombinant Human Paired Box Protein Pax-8 (PAX8) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-11123P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Paired Box Protein Pax-8 (PAX8) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-11123P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Human Paired Box Protein Pax-8 (PAX8) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q06710
Target Symbol PAX8
Synonyms OTTHUMP00000158659; OTTHUMP00000158660; OTTHUMP00000203723; OTTHUMP00000203724; Paired box 8; Paired box gene 8; paired box homeotic gene 8; Paired box protein Pax 8; Paired box protein Pax-8; Paired domain gene 8; PAX 8; PAX8; PAX8_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Expression Range 1-450aa
Protein Length Full Length
Mol. Weight 55.7 kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.
Subcellular Location Nucleus.
Database References
Associated Diseases Hypothyroidism, congenital, non-goitrous, 2 (CHNG2)
Tissue Specificity Expressed in the excretory system, thyroid gland and Wilms tumors.

Gene Functions References

  1. PAX8-PPARG fusions may not play major roles in the tumorigenesis of paediatric follicular thyroid carcinoma. PMID: 28621837
  2. Identify several novel PAX8 mutations in congenital hypothyroidism patients that impair the binding or activating abilities of PAX8 at the promoters of the target genes thyroglobulin and thyroperoxidase. PMID: 28060725
  3. Data suggest that candidate genes and pathways regulated by PAX8 that could be additional targets for the therapy of ovarian carcinoma. PMID: 27259239
  4. PAX8 has a cell specific role in governing proliferation and migration in nontransformed ovarian surface epithelium cells compared to the oviductal cells, but its reduction in serous cancer cell lines provides a common mechanism for reducing cell survival. PMID: 27129161
  5. findings proved that iodinated TG in thyroid follicular lumen regulated TTF-1 and PAX8 expression through thyroid stimulating hormone/thyroid stimulating hormone receptor (TSH/TSHR) mediated cAMP-PKA and PLC-PKC signaling pathways. PMID: 28322461
  6. Case Report: primary seminal vesicle carcinoma strong and diffuse nuclear labeling for PAX8. PMID: 28506732
  7. PAX8 is expressed in both benign and malignant mesothelium, and that BAP1 loss is highly specific for malignant peritoneal neoplasms, in the differential with both benign mesothelial proliferations and ovarian serous tumors. PMID: 28877056
  8. Although the exact biological function remains to be explored, our findings suggest a possible association of PAX8eQTLs in lncRNA AC016683.6 with the hepatocellular carcinoma prognosis in the Chinese population. PMID: 28339471
  9. findings point to significant PTC-associated dysregulation of several PAX8 target genes, supporting the notion that PAX8-regulated molecular cascades play important roles during thyroid tumorigenesis PMID: 27249794
  10. Putative PAX8 target genes are enriched for common serous epithelial ovarian cancer risk variants. PMID: 28103614
  11. We conclude that PAX8 immunostain is negative in most cervical cell carcinomas and is less frequently expressed in endocervical adenocarcinomas as compared with the previously reported high sensitivity for ovarian and endometrial adenocarcinomas PMID: 27362905
  12. Study postulated that both TTF-1 and PAX-8 when co-expressed and have anti-proliferative and anti-tumorigenic properties up to a threshold expression level and beyond that, are able to induce pro-tumorigenic effects in thyroid carcinomas. PMID: 27573549
  13. Direct sequencing of the PAX8 gene revealed a novel single nucleotide substitution (c.162 A>T) in exon 2 that resulted in the substitution of the normal serine 54 with a cysteine (S54C), which segregated with elevated serum TSH levels. PMID: 27207603
  14. This is the first report of PAX8 aberrant transcript production in cervical cancer. Reported PAX8 isoforms possess differential transactivation properties; therefore, besides being a helpful marker for detection of cancer, PAX8 isoforms can plausibly exert differential regulation properties during carcinogenesis PMID: 27175788
  15. PAX2, PAX8, CDX2 immunostains was preformed to the TMA slides. PMID: 26797858
  16. Pax8 gene Rearrangement is associated with Breast Cancer. PMID: 27797226
  17. PAX8 was negative in all cases of pulmonary neuroendocrine carcinoma (PNEC) while positive in 86.4% of thymic cases (TNEC). TTF-1 positivity was associated with high sensitivity but low specificity for PNEC, and adding PAX8 negativity significantly increased the specificity. PAX8 positivity alone showed essentially 100% specificity and 86.4% sensitivity for TNEC. PMID: 27761900
  18. Study suggested that PAX8 eQTLs SNPs (rs4848320 and rs1110839) located in lncRNA PAX8-AS1 might predict decreased risk of cervical cancer. PMID: 27225188
  19. High Levels of mRNA of both PAX8 are associated with benign than in malignant thyroid lesions. PMID: 26370671
  20. results indicate that presence of PAX8 immunoreactivity in an undifferentiated brain tumor lacking gliofibrillary acidic protein expression should prompt consideration of a metastatic tumor PMID: 26371431
  21. rete ovarii were positive for PAX-8, weakly positive for SF-1, and negative for PAX-2 and GATA-3 PMID: 26352548
  22. showing that the PAX8 mutation rate is very low in thyroid dysgenesis patients in China PMID: 26617871
  23. a substantial minority of solitary fibrous tumors express nuclear PAX8 and PAX2 PMID: 26404914
  24. PAX8 staining is useful for distinguishing between primary thyroid squamous cell carcinoma and invasion or metastasis from extrathyroidal squamous cell carcinoma. PMID: 26354716
  25. PAX8 is expressed in the majority of benign, premalignant, and malignant endocervical glandular lesions. PMID: 26910219
  26. PAX8 mutation rate among congenital hypothyroidism patients PMID: 26362610
  27. the novel interplay between PAX8 and Neuropilin-2 PMID: 26030152
  28. Heterozygous transition in exon 3 of PAX8 gene is associated with hyroid hypoplasia. PMID: 25720050
  29. miR-146b-3p binds to the 3'-untranslated region of PAX8 and sodium/iodide symporter. miR-146b and PAX8 regulate each other and share common target genes. PMID: 26282166
  30. we examined PAX8-PPARgamma rearrangement in 24 follicular thyroid carcinoma samples from Japanese patients. The fusion gene was detected in only one of 24 follicular thyroid carcinomas (4%). PMID: 25708358
  31. PAX8 protein expression was associated with germinal layers in forebrain and hindbrain development...and PAX8 expression is linked to better prognosis in medulloblastomas PMID: 25287489
  32. PAX2 and PAX8 are useful biomarker in the differential diagnosis of ovarian serous and mucinous tumors PMID: 24992169
  33. immunohistochemical marker, which allows to differentiate seminal vesicle from prostate gland epithelium in prostate needle biopsies PMID: 25153494
  34. PAX6 and PAX8 positivity was seen in of metastatic pancreatic neuroendocrine tumors to the liver PMID: 25433656
  35. In this series, PAX8/PPARgamma rearrangement found in thyroid nodules had a 100% predictive value for differentiated thyroid cancer PMID: 24798894
  36. Compared with RAS or PAX8/PPARG-positive TCs, BRAFV600E or RET/PTC-positive Thyroid cancers were more often associated with stage III/IV disease and recurrence. PMID: 26258321
  37. PAX8 (mAb) was a specific marker in differentiating primary and extragenital metastatic mucinous ovarian tumours. PMID: 25827135
  38. PAX8 is frequently expressed by ovarian surface epithelial cells, and endogenous levels of PAX8 expression are non-transforming. PMID: 26079312
  39. Case Report: novel PAX8 mutation is responsible for a severe form of dominantly inherited congenital hypothyroidism. The mutation seems to be associated with abnormalities of the urogenital tract. PMID: 23647375
  40. PAX8 immunoexpression was noticed in five and three cases of alveolar rhabdomyosarcomas and embryonal rhabdomyosarcomas, respectively. About one-third of malignant rhabdoid tumors were PAX2-positive and PAX8-positive. PMID: 24897005
  41. PAX8 is expressed in the vast majority of uterine adenocarcinomas, and that the level of expression based on combined extent and intensity is highest in endometrial serous carcinoma and lowest in endocervical adenocarcinoma. PMID: 25083965
  42. useful in distinguishing thymic carcinoma from poorly differentiated lung carcinoma PMID: 23958552
  43. We reviewed the reliability of PAX8 to determine tumor type or primary site in 135 current clinical pelvic or abdominal lesions PMID: 24857336
  44. The 5'-flanking region of the Wnt4 gene is responsive to Pax8. Pax8 modulates the expression of Wnt4 in thyroid cells. PMID: 25270402
  45. our results indicate that PAX8 plays an important role in the tumorigenic phenotype of ovarian cancer cells and identifies PAX8 as a potential new target for the treatment of ovarian cancer. PMID: 24766781
  46. PAX8 is expressed in the carcinomatous components of nearly all uterine malignant mesodermal mixed tumors, with expression in sarcomatous and undifferentiated components being less common and less extensive. PMID: 24901404
  47. This study confirms that PAX-8 expression is a useful diagnostic marker for renal cell carcinoma PMID: 25315900
  48. PAX8 is increased in the majority of glioblastomas and promoted cell survival. PMID: 24602166
  49. R133W-PAX8 variant is associated with phenotype ranging from congenital hypothyroidism with thyroid hypoplasia to mild subclinical hypothyroidism. PMID: 25146893
  50. Data shows that PAX8 provides signals for growth and motility of non-small cell lung cancer cells and is necessary for MET and RON expression. PMID: 24628993

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed