Recombinant Human Paired Box Protein Pax-5 (PAX5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00079P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Paired Box Protein Pax-5 (PAX5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00079P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Paired Box Protein Pax-5 (PAX5) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q02548 |
| Target Symbol | PAX5 |
| Synonyms | B cell lineage specific activator; B cell lineage specific activator protein; B cell specific activator protein; B cell specific transcription factor; B-cell-specific transcription factor; BSAP; EBB-1; KLP; Paired box 5; Paired box gene 5 (B cell lineage specific activator protein); Paired box gene 5 (B cell lineage specific activator); Paired box gene 5; Paired box homeotic gene 5; Paired box protein Pax 5; Paired box protein Pax-5; Paired domain gene 5; PAX 5; PAX5; PAX5_HUMAN; Transcription factor PAX 5 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH |
| Expression Range | 1-391aa |
| Protein Length | Full Length |
| Mol. Weight | 47.2 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes. In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage. Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire.; (Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription. Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity. |
| Subcellular Location | Nucleus. |
| Database References | HGNC: 8619 OMIM: 167414 KEGG: hsa:5079 STRING: 9606.ENSP00000350844 UniGene: PMID: 30257940 |
