Recombinant Human Paired Box Protein Pax-5 (PAX5) Protein (His&Myc)

Name: Recombinant Human Paired Box Protein Pax-5 (PAX5) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00079P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Paired Box Protein Pax-5 (PAX5) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q02548
Target Symbol	PAX5
Synonyms	B cell lineage specific activator; B cell lineage specific activator protein; B cell specific activator protein; B cell specific transcription factor; B-cell-specific transcription factor; BSAP; EBB-1; KLP; Paired box 5; Paired box gene 5 (B cell lineage specific activator protein); Paired box gene 5 (B cell lineage specific activator); Paired box gene 5; Paired box homeotic gene 5; Paired box protein Pax 5; Paired box protein Pax-5; Paired domain gene 5; PAX 5; PAX5; PAX5_HUMAN; Transcription factor PAX 5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Expression Range	1-391aa
Protein Length	Full Length
Mol. Weight	47.2 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes. In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage. Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire.; (Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription. Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity.
Subcellular Location	Nucleus.
Database References	HGNC: 8619 OMIM: 167414 KEGG: hsa:5079 STRING: 9606.ENSP00000350844 UniGene: Hs.654464
Associated Diseases	Leukemia, acute lymphoblastic, 3 (ALL3)

Gene Functions References

The functional role of PAX5-ELN as a potent oncoprotein in B-cell acute lymphoblastic leukemia development. PMID: 30257940
PAX5 gene methylation can predict poor survival outcomes and cisplatin sensitivity in esophageal squamous cell carcinomaand could be a useful diagnostic tool for cancer therapy selection PMID: 29099287
Study demonstrated that Pax-5 regulates numerous miRNAs including miR-215 which is aberrantly under-expressed in breast cancer tumors. Pax-5 was found to inhibit aggressive features of breast cancer cells in a miR-215- dependent manner. PMID: 30194145
The correlation between Pax5 deletion and patients survival in Iranian children with precursor B-cell acute lymphocytic leukemia hs been reported. PMID: 28886309
this study demonstrates a role for the AHR in regulating human B cell development, and it suggests that transcriptional alterations of PAX5 by the AHR are involved in the underlying mechanism PMID: 28978690
These findings suggested that pax5 is critically important for the proliferation and survival of pre-B cells. PMID: 27016671
a mechanism of transcriptional regulation mediated by p27, Pax5, and PCAF PMID: 28158851
Data show that paired box gene 5 (B-cell lineage specific activator) protein (Pax-5) induces E-cadherin expression in breast cancer cells. PMID: 28076843
PAX5-KIDINS220 fusion is associated with Philadelphia-like acute lymphoblastic leukemia. PMID: 27870151
this study shows that Pax5 expression is lower in antibody-secreting cells than in naive B cells or plasmablasts PMID: 27525369
The histological observations suggested that the patients represent diverse cases of NHL like mature B-cell type, mature T-cell type and high grade diffuse B-cell type NHL. The findings indicate that patients with NHL may also be analyzed for status of PAX5, CD19 and ZAP70, and their transcriptional and post-translational variants for the differential diagnosis of NHL and therapy. PMID: 27748274
B cell receptor signaling component, SYK, caused PAX5 tyrosine phosphorylation in vitro and in cells. Transcriptional repression on the BLIMP1 promoter by PAX5 was attenuated by this phosphorylation. PMID: 27181361
PAX5 haploinsufficiency promotes tumorigenesis and may be related to genomic instability, immune tolerance, and tumor pathways PMID: 28316978
FISH studies showed false-negative results in 10, 40, and 28% of the samples tested for the IKZF1,PAX5, and CDKN2A/B gene deletions, respectively. The PAX5 and IKZF1 abnormalities are highly specific to B-ALL and can be used as diagnostic markers PMID: 28214896
The Correlation between GATA5, WT1 and PAX5 methylation and clinical/histological parameters is suggestive of applicability of these markers in non-invasive (epi)genetic testing in hepatocellular carcinoma (HCC). PMID: 27171388
we identified gene promoter methylation signatures (WT1, MSH6, GATA5 and PAX5) that are strongly correlated to, and can have a predictive value for the clinical outcome of oral squamous cell carcinoma patients PMID: 27491556
PAX5 expression is infrequent (27.27%) in Olfactory neuroblastoma; however, if present it can be associated with a very aggressive clinical course. PMID: 27543867
Report Pax5 expression is common in combined Merkel cell carcinoma. PMID: 27322785
PAX5 was found to be an epigenetically inactivated tumor suppressor that inhibited non-small-cell lung proliferation and metastasis, through down-regulating the beta-catenin pathway and up-regulating GADD45G expression. PMID: 26843424
Our findings suggest that this mutation in a single allele of the PAX5 gene is not sufficient to cause disease, and it is possible that other alleles are also involved in the onset of B-ALL. PMID: 26782422
PAX5 methylated imprint margins may signify recurrence in head and neck squamous cell carcinoma PMID: 26304463
Authors demonstrate leukemogenicity of PAX5-PML by introducing it into normal mouse pro-B cells; B-cell linker protein (Blnk) is repressed by PAX5-PML in leukemia cells; enforced expression of Blnk increases survival despite introduction of PAX5-PML. PMID: 26703467
PAX5 deletion is an independent risk factor for DFS in B-ALL children. PMID: 27097569
Differential PAX5 levels promote malignant B-cell infiltration, progression and drug resistance, and predict a poor prognosis in mantle cell lymphoma patients independent of CCND1. PMID: 26073757
This is the first reported case of a novel complex variant translocation of t(11;14)(q13;q32) and t(9;14)(p13;q32)in PAX5-positive plasma cell myeloma. PMID: 25633778
Cells from PAX5 translocated patients show LCK up-regulation and over-activation, as well as STAT5 hyper-phosphorylation, compared to PAX5 wt and PAX5 deleted cases. PMID: 25595912
Increased hypermethylation of PAX5 is associated with Triple negative breast cancer. PMID: 25684485
PAX5 gene translocation is associated with B-cell precursor acute lymphoblastic leukemia. PMID: 25304615
These findings indicated that the methylated CpG -236 of PAX5 promoter has the potential applicability for clinical evaluation the prognosis of gastric cancer PMID: 25277182
We report the immunoreactivity expression patterns of three PAX genes (PAX2, PAX5 and PAX8) in poorly differentiated small round cell tumors of childhood for possible useful diagnostic applications. PMID: 24897005
PAX5-JAK2 simultaneously deregulates the PAX5 downstream transcriptional program and activates the Janus kinase-STAT signaling cascade and thus, by interfering with these two important pathways, may promote leukemogenesis. PMID: 25515960
a novel link wherein placenta growth factor-mediated downregulation of paired box protein 5 attenuates miR-648 expression leading to increased endothelin-1 levels that are known to induce Pulmonary hypertension in sickle cell anemia PMID: 25403488
Study identified PAX5 as a novel EBER2-interacting protein, prompted by the observation that this transcription factor and the viral noncoding RNA co-localize at the tandem repeats, interaction appears to be indirect, based on the negative results of electrophoretic mobility shift assays and UV crosslinking experiments. PMID: 25662012
Data show that leukemia-associated PAX5 fusion proteins share some dominating characteristics such as nuclear localization and DNA binding but also show distinctive features. PMID: 24435167
MCOLN2 is transcriptionally activated by PAX5 and has roles in B cell development and function PMID: 25445271
Downregulation of PAX6 in SS patients was highly associated with ocular surface damage and largely dependent on the level of inflammation. PMID: 25228544
Data indicate that somatic PAX5 mutation may be a rare event in multiple myelomas and DLBCL, and may not contribute to development of these malignancies of Korean patients. PMID: 23737402
Low PAX5 expression is associated with atypical non-Langerhans cell histiocytic tumor post acute lymphoblastic leukemia. PMID: 24569775
data clearly demonstrate that the expression of PAX5 with or without global DNA demethylation/histone acetylation is not sufficient to induce a B-cell phenotype in HRS cells. PMID: 23842424
The frequency of PAX5 gene alterations in B cell acute lymphoblastic leukemia harboring 9p abnormalities was 52%. PMID: 24078568
data extend the role of PAX5 alterations in the pathogenesis of pre-B cell ALL and implicate PAX5 in a new syndrome of susceptibility to pre-B cell neoplasia PMID: 24013638
Deregulated MAP kinase signaling in t(8;21) Acute myeloid leukemia abrogates the association of polycomb complexes to PAX5 and leads to aberrant gene activation. PMID: 23616623
The B-cell-specific transcription factor and master regulator Pax5 promotes Epstein-Barr virus latency by negatively regulating the viral immediate early protein BZLF1. PMID: 23678172
The purpose of this study was to evaluate the expression patterns of B-cell specific activator protein (BSAP)/PAX5 and PAX8 in a wide variety of B-cell and T-cell neoplasms PMID: 23163626
Our study confirms that PAX5 and TdT expression can be expressed in a high percentage of Merkel cell carcinomas and so when positive are not diagnostic of lymphoblastic leukemia/lymphoma. PMID: 23329999
first, PAX5/ETV6 determines a PAX5 haploinsufficiency setting; second, the fusion protein could be responsible for the B-cell development block PMID: 23090680
PAX5 emerges as one of the major SOX11 direct targets. SOX11 silencing downregulates PAX5. PMID: 23321250
reduced expression of huPax5 during the induction of early lymphoid progenitors to B-lineage-committed cells can fix this cellular development at a stage that has previously been seen during embryonic development PMID: 22927250
Pax-5 plays a key role in phenotypic transitioning during metastasis through the regulation of FAK1 activity. (Review) PMID: 21707507
PAX5 is a novel functional tumor suppressor in gastric carcinogenesis PMID: 22105368

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.