Recombinant Human Oxytocin-Neurophysin 1 (OXT) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-02830P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Oxytocin-Neurophysin 1 (OXT) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-02830P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Oxytocin-Neurophysin 1 (OXT) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P01178
Target Symbol OXT
Synonyms OXT; OT; Oxytocin-neurophysin 1; OT-NPI) [Cleaved into: Oxytocin; Ocytocin); Neurophysin 1]
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Expression Range 32-125aa
Protein Length Partial
Mol. Weight 14.6kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).
Subcellular Location Secreted.
Protein Families Vasopressin/oxytocin family
Database References

HGNC: 8528

OMIM: 167050

KEGG: hsa:5020

STRING: 9606.ENSP00000217386

UniGene: PMID: 28566712

  • Although some SNPs were associated at an alpha level of .05 with breastfeeding, they did not survive multiple testing correction. Authors conclude that SNPs within or nearby OXT and OXTR are unlikely to have large effects on breastfeeding behavior. PMID: 29412506
  • Oxytocin gene polymorphisms and parenting G x E interaction on social anxiety levels in adolescents. PMID: 28606214
  • serum oxytocin levels were higher among women than men and were negatively associated with strength of belief in life after death PMID: 26898770
  • A significant moderating effect of OXT genotype (rs2740210) on the relationship between social support and psychiatric distress was detected PMID: 29040351
  • findings suggested more significant plasma oxytocin dysregulation in the patients in the bipolar II disorder group than in the major depressive disorder patients and controls, both before and after treatment PMID: 28865715
  • Oxytocin level did not vary significantly between healthy controls, healthy controls with a history of sexual abuse, and psychogenic non-epileptic seizure patients with a history of sexual abuse. PMID: 28927333
  • These results suggest that OXT and OXTR are controlled mainly by E2 in the placenta via ESR1 and thus may play physiological functions in the human placenta during the late stage of pregnancy. PMID: 28694300
  • Study found a higher expression of paraventricular nucleus OXT in the mood disorder patients than in the control subjects, and observed a clear co-localization of androgen receptor in OXT-expressing neurons, both in the cytoplasm and in the nucleus. In addition, a significant decrease in OXT-mRNA levels was observed after pre-incubation of the SK-N-SH cells with testosterone. PMID: 28447621
  • Serum and prostatic oxytocin levels are increased in the PCa subjects. Serum oxytocin level may be a biomarker for PCa in the future. Oxytocin increases PCa growth and APPL1 expression. PMID: 28415720
  • Obese children had significantly higher irisin and lower oxytocin levels than the healthy controls. PMID: 28077341
  • study found that rs6133010 in the OXT gene is associated with alcohol dependence in the northern Chinese Han population PMID: 27818356
  • OXT levels were lowest in anorexia nervosa, higher in healthy controls, and highest in obesity. There were positive associations between OXT and body mass index, total, visceral, and subcutaneous fat, and bone mineral density. PMID: 28586943
  • epigenetic modification of OXT is linked to several overt measures of sociability PMID: 27325757
  • Hormonal changes in estradiol, progesterone, or oxytocin do not predict differences in the pain perception of women in the peripartum or postpartum period. PMID: 27028773
  • Oxytocin prevents cartilage matrix destruction via regulating MMP1 and MMP13. PMID: 28238786
  • Low oxytocin expression is associated with diabetic metabolic syndrome. PMID: 27578619
  • Oxytocin levels were lower in autistic patients compared to controls. PMID: 26739971
  • Children with Prader-Willi syndrome have elevated plasma oxytocin levels. PMID: 26615966
  • This is the first known study to show a significant association between callous unemotional traits in children and adolescents with extreme, persistent pervasive aggression and a polymorphism on the oxytocin receptor. PMID: 22294460
  • Oxytocin serum levels with Attention Deficit Hyperactivity Disorder were significantly decreased compared with controls. PMID: 26168929
  • reviews the role of OT in the control mechanisms of sexual behavior. PMID: 25088178
  • Oxytocin activates NF-kappaB-mediated inflammatory pathways in human gestational tissues in normal parturition. PMID: 25451977
  • Report for the first time of a significant genetic association of OXT and AVP with schizophrenia PMID: 21899794
  • nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38 PMID: 24635660
  • findings suggest that experiences of childhood emotional maltreatment may alter salivary oxytocin levels, which in turn are related to more positive perceptions of infant stimuli with positive emotion PMID: 24768649
  • Patients with poor outcome after aneurysmal subarachnoid hemorrhage have lower AVP and OXT levels in cerebrospinal fluid. PMID: 24412107
  • dysregulation of OXT, AVP and/or testosterone systems exist in mothers of autistic children. PMID: 24086383
  • OXT rs2740210 interacted with early life adversity to predict variation in breastfeeding duration and postpartum depression. PMID: 23941164
  • Women with low OT may not effectively interpret and utilize available support resources, which may be associated with sleep disturbances PMID: 23799864
  • Oxytocin plays an important role in modulation of social bonding processes and stress regulation, and may be crucially involved in the promotion of mental health. Review. PMID: 23856187
  • Data from women undergoing hysterectomy for uterine fibroids suggest that uterine isthmian-cervical myoma pseudocapsules exhibit substantial nerve fibers expressing OXT; uterine fundal myoma pseudocapsules exhibit few nerve fibers expressing OXT. PMID: 23937196
  • Data suggest that that OXT enhances pro-social behavior by influencing complex brain networks involved in self-referential processing and affectionate touch, most prominently in individuals with supportive family experiences in childhood. PMID: 23453164
  • findings suggest that oxytocin might not promote human bond formation in ways analogous to prairie voles - that is, by inducing a partner preference effect PMID: 22920910
  • OT increases covert attention to happy faces, thereby supporting the hypothesis that OT modulates early attentional processes that might promote prosocial behavior in healthy men. PMID: 23146328
  • In couples, relationship quality had a small, marginally significant inverse association with plasma oxytocin levels. PMID: 22543270
  • polymorphisms in OXT associate with both infant-directed vocalizing and maternal instrumental care. PMID: 23637833
  • Results indicate that oxytocin, beyond its role in social bonding, regulates non-homeostatic, reward-related energy intake, hypothalamic-pituitary-adrenal axis activity, and the glucoregulatory response to food intake in humans. PMID: 23835346
  • OT inhibits neuroadaptation to and withdrawal from alcohol. PMID: 23025690
  • OT is a regulator of the PI3K/Akt/mTORC1 pathway in Caco2BB cells and may modulate translation in gut cells. PMID: 23410756
  • kisspeptin-10 transiently excites oxytocin neurons in late pregnancy and during lactation, suggesting that a central kisspeptin excitation of oxytocin neurons emerges at the end of pregnancy PMID: 23550008
  • Women who perceived low cognitive social capital showed higher oxytocin levels, while structural social capital showed inverse-U shape association with oxytocin. No association between oxytocin and social capital was found among men. PMID: 23284856
  • oxytocin and argipressin have been referred to as "social" neuropeptides as they have a highly conserved role as mediators of complex social cognition and interaction in both animals and humans PMID: 23589638
  • The study links defense-motivated competition to oxytocin, a hypothalamic neuropeptide involved in reproduction and social bonding. PMID: 23144787
  • Results show low plasma oxytocin levels in patients with generalized social anxiety disorder compared to controls during a prosocial laboratory task paradigm. PMID: 22807189
  • Data suggest that nocturnal oxytocin secretion is low in amenorrheic athletes compared with nonathletes and is associated with site-dependent microarchitectural parameters of bone (tibia [weight-bearing]; radius [non-weight-bearing]). PMID: 23258269
  • [review] The OT system functions as an important element within a complex, developmentally sensitive biobehavioral system. PMID: 21984889
  • Data suggest that plasma oxytocin is lower in subjects with uncontrolled type 2 diabetes along with psychoticism, somatization, or obsessionality as compared with subjects with controlled type 2 diabetes. PMID: 22997507
  • first evidence or relationship between plasma oxytocin level and expression of SERT (serotonin transporter) on platelet membranes PMID: 22297159
  • Oxytocin may be involved in the pathophysiology of anorexia. PMID: 22872688
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed