Recombinant Human Osteocalcin Protein
Beta LifeScience
SKU/CAT #: BLA-6500P
Recombinant Human Osteocalcin Protein
Beta LifeScience
SKU/CAT #: BLA-6500P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P02818 |
Synonym | BGLAP BGP Bone gamma carboxyglutamate (gla) protein Bone gamma carboxyglutamate gla protein osteocalcin Bone gamma carboxyglutamate protein Bone Gla protein Gamma carboxyglutamic acid containing protein Gamma-carboxyglutamic acid-containing protein OC OCN OSTCN_HUMAN Osteocalcin OTTHUMP00000016586 PMF1 |
Description | Recombinant Human Osteocalcin Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Molecular Weight | 31 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |