Recombinant Human Orexin Receptor Type 1 (HCRTR1) Protein (His-sumostar)

Name: Recombinant Human Orexin Receptor Type 1 (HCRTR1) Protein (His-sumostar)
Brand: Beta LifeScience
SKU: BLC-02120P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Orexin Receptor Type 1 (HCRTR1) Protein (His-sumostar) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O43613
Target Symbol	HCRTR1
Synonyms	HCRTR1; Orexin/Hypocretin receptor type 1; Hypocretin receptor type 1; Orexin receptor type 1; Ox-1-R; Ox1-R; Ox1R
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His-sumostar
Target Protein Sequence	MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Expression Range	1-46aa
Protein Length	Full Length
Mol. Weight	21.4 kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 4848 OMIM: 602392 KEGG: hsa:3061 STRING: 9606.ENSP00000362810 UniGene: PMID: 30251681 In this study we demonstrate a new role of MRAP2 in the regulation of the orexin receptor 1 (OX1R) and identify the specific regions of MRAP2 required for the regulation of OX1R and PKR1. Importantly, like MC4R and PKRs, OX1R is predominately expressed in the brain where it regulates food intake PMID: 28939058 After sequencing all orexin receptor exons, one variation (rs2271933) in the OX1R gene and one variation (rs2653349) in the OX2R gene were found. However, no significant differences were found in either genotypic or allelic frequency distributions between the two study groups PMID: 27988352 G-protein-dependency of OX1 receptor signalling PMID: 27237973 Several single nucleotide polymorphisms (SNPs) in HCRTR2 were nominally associated with Antipsychotic-induced weight gain (AIWG) in patients of European ancestry treated with either clozapine or olanzapine. None of the SNPs in HCRTR1 were associated with AIWG. PMID: 26447462 Rapid-onset obesity with hypothalamic dysfunction, hypoventilation, and autonomic dysregulation is highly unlikely to be caused by mutations in the exons of the HCRTR1 gene. PMID: 26555080 This study determined structures of OX1R bound to the OX1R-selective antagonist SB-674042 and the dual antagonist suvorexant at 2.8-A and 2.75-A resolution. PMID: 26950369 the orexinA/OX1 receptor axis has a significant pro-survival function in adrenal cells. PMID: 26459696 OX1R signaling can attenuate KOR-mediated reduction of cellular cAMP levels while enhancing KOR-mediated beta-arrestin recruitment and p38 activation. PMID: 25857454 OX1R and KOR heterodimerize, and this heterodimer associates with Galphas, leading to increased protein kinase A (PKA) signaling pathway activity, including upregulation of intracellular cAMP levels. PMID: 25866368 No significant differences were found in the distribution of either genotypic or allelic frequencies between Alzheimer's disease cases and controls in the HCRTR1 polymorphisms. PMID: 24969517 Orexins modifiy orexin receptor gene expression and gonadotropin release from the anterior pituitary gland. PMID: 24333629 DQ B1 but not HLA-DR typing, TNF-alpha levels, HCRTR1 and HCRTR2 were higher in narcolepsy-cataplexy/schizophrenia patients. PMID: 24268496 The present data indicate that OX1R-driven apoptosis is overexpressed in androgeno-independent prostate cancer exhibiting a neuroendocrine differentiation opening a gate for novel therapies for these aggressive cancers which are incurable until now. PMID: 24910418 Both orexin receptor subtypes, OX1R and OX2R, and CB1 cannabinoid receptors are capable of forming constitutive homo- and heteromeric complexes. PMID: 24530395 [review] Native orexin peptides consist of receptor agonists, orexin-A (33 amino acids) and orexin-B (28 amino acids) (aka hypocretin-1 and hypocretin-2). PMID: 23034387 Orexin receptors generate potent endocannabinoid signals in addition to arachidonic acid signals, which may explain the proposed orexin-cannabinoid interactions. PMID: 22550093 decreased ventilatory responses to hypoxia in human narcolepsy-cataplexy is in relation to HLA-DQB1*0602 status, not hypocretin deficiency PMID: 21318258 Intramolecular fluorescence resonance energy transfer (FRET) sensors of the orexin OX1 and OX2 receptors identify slow kinetics of agonist activation. PMID: 22389503 HCRTR1 gene could represent a genetic susceptibility factor for migraine without aura; the hypocretin system may have a role in the pathophysiology of migraine. PMID: 21344296 The Ile408Val polymorphism in the hypocretin receptor 1 (HCRTR1) gene and the Val308Iso (G1246A) polymorphism in the hypocretin receptor 2 (HCRTR2) gene in a sample of 215 panic disorder patients and 454 controls, were analyzed. PMID: 21666548 Data show that the HCRTR1 gene or a linked locus may modulate the risk for Major Mood Disorders and supports recent studies suggesting an involvement of hypocretin neurotransmitter system in affective disorders. PMID: 21071097 Results show that the N-terminal regions of orexin receptor are most important, and the exchange of the area from the C-terminal part of the transmembrane helix 2 to the transmembrane helix 4 is enough to lead to a change of the receptor's ligand profile. PMID: 21510948 analysis of orexin receptor 1 and 2 -arrestin-ubiquitin complexes PMID: 21378163 In differentiated IMR-32 neuroblastoma cells orexin/hypocretin and bradykinin receptors activate TRPC3/6 channels. PMID: 20728215 Data demonstrate the functional role of protein kinase D1 and protein kinase D3 in modulating physiological responses to Ox1R activation. PMID: 20621130 OX1 orexin receptor activation results in robust arachidonic acid release. PMID: 20002100 It was shown here that another motif, immunoreceptor tyrosine-based switch motif, is present in orexin receptor-1 (OX1R) and is mandatory for OX1R-mediated apoptosis. PMID: 19661287 The SK-N-MC cell line expresses an orexin binding site different from recombinant orexin 1-type receptor. PMID: 11856342 evidence that CB1 is able to potentiate an orexigenic receptor, OX1R PMID: 12690115 both OX1R and OX2R are expressed in the testis, epididymis, penis, and seminal vesicle PMID: 15070969 OX(1) receptors stimulate adenylyl cyclase via a low potency G(s) coupling and a high potency phospholipase C --> PKC coupling. PMID: 15611118 All adrenal corttex adenomas expressed OX1-R and OX2-R mRNAs, and real-time PCR showed that the expression of both receptors was up-regulated in adenomas PMID: 15797953 Our preliminary data suggest that mutation hcrtr1 might have an increased susceptibility to polydipsia through an undetermined mechanism. PMID: 15978554 Orexins act exclusively through OX1-receptors coupled to the adenylate cyclase/protein kinase A-dependent signaling cascade. PMID: 16157481 OX1 orexin/hcrtr-1 hypocretin receptors induce caspase-dependent and -independent cell death through p38 mitogen-/stress-activated protein kinase PMID: 16282319 This is the first demonstration of loss of Hcrt/Orx neurons in MSA, which is consistent with a system degeneration of neurons involved in homeostatic function, including sleep and autonomic regulation, in this disorder. PMID: 17089135 Results support the hypothesis that the HCRTR1 Ile408Val polymorphism may confer susceptibility to polydipsia in schizophrenia. PMID: 17999203 orexin-induced apoptosis is driven by an immunoreceptor tyrosine-based inhibitory motif (ITIM) present in the OX1R and is mediated by SHP-2 phosphatase recruitment via a mechanism that requires Gq protein but is independent of phospholipase C activation. PMID: 18198212 Both sporadic narcoleptic dogs and human narcolepsy-cataplexy subjects showed a significant decrease in hcrtR1 expression, while declines in hcrtR2 expression were not significant in these cases. PMID: 18714784 Induction of intracellular calcium signaling in isolated duodenal enterocytes is mediated primarily by OX1R receptors PMID: 19118115 OX1R are able to activate TRPC(3)-channel-dependent oscillatory responses independently of store discharge. PMID: 19464259

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.