Recombinant Human Oncostatin-M (OSM) Protein (hFc)

Name: Recombinant Human Oncostatin-M (OSM) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-06333P
Price: 240.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Back to school. back to lab. ready for results. - advance your research with beta lifescience, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins

Price Save $252

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Oncostatin-M (OSM) Protein (hFc) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P13725
Target Symbol	OSM
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	N-hFc
Target Protein Sequence	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Expression Range	26-221aa
Protein Length	Partial
Mol. Weight	44.1 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Subcellular Location	Secreted.
Protein Families	LIF/OSM family
Database References	HGNC: 8506 OMIM: 165095 KEGG: hsa:5008 STRING: 9606.ENSP00000215781 UniGene: PMID: 29269396 OSM [oncostatin M]might be involved in the invasiveness of extravillous trophoblasts under hypoxia conditions via increasing MMP-2 and MMP-9 enzymatic activities through STAT3 signaling. Increased MMP-9 activity by OSM seems to be more important in primary trophoblasts. PMID: 30091322 IL6 family cytokine oncostatin-M (OSM) induced a switch to the EMT phenotype and protected cells from targeted drug-induced apoptosis in OSM receptors (OSMRs)/JAK1/STAT3-dependent manner PMID: 28729401 Oncostatin M induces RIG-I and MDA5 expression and enhances the double-stranded RNA response in fibroblasts. PMID: 28560754 The IL-6-type cytokine oncostatin M (OSM) indeed induces cellular properties associated with tumorigenesis and disease progression in non-transformed human prostate epithelial cells, including morphological changes, epithelial-to-mesenchymal transition (EMT), enhanced migration and pro-invasive growth patterns. PMID: 29526757 downregulation of miR-20a-5p is caused by promoter hypermethylation. MiR-20a-5p could also suppress the production of IL-17 by targeting OSM and CCL1 production in CD4(+) T cells in patients with active VKH. PMID: 28972028 our findings suggested that OSM suppresses SLUG expression and tumor metastasis of lung adenocarcinoma cells through inducing the inhibitory effect of the STAT1-dependent pathway and suppressing the activating effect of STAT3-dependent signaling PMID: 27486982 Genistein (a specific Tyr phosphorylation inhibitor) leads to the interaction of CHOP (C/EBP Homologous Protein) with C/EBP-beta, thus negatively regulating it. Knockdown of C/EBP-beta also leads to inhibition of PMA-mediated OSM induction. PMID: 27676154 Data provide evidence that OSM regulates an epithelial-mesenchymal transition and cancer stem cell plasticity program that promotes tumorigenic properties in pancreatic cells. PMID: 28053127 OSM-induced plasticity was Signal Transducer and Activator of Transcription 3 (STAT3)-dependent, and also required a novel intersection with transforming growth factor-beta (TGF-beta)/SMAD signaling. Removal of OSM or inhibition of STAT3 or SMAD3 resulted in a marked reversion to a non-invasive, epithelial phenotype. PMID: 28288136 Neutrophils are a major source of OSM-producing cells in patients with chronic rhinosinusitis and severe asthma. PMID: 27993536 OSM and OSMR are highly expressed in inflammatory bowel disease intestinal mucosa compared to control mucosa. OSM promotes inflammatory behavior in human intestinal stroma. PMID: 28368383 Study showed that in atrial fibrillation (AF) with thrombus, the atrial tissue infiltration of M1 macrophages increased significantly; the OSM expression was also found to increase simultaneously; downstream tissue factor (TF) increased and tissue factor pathway inhibitors (TFPI)decreased, leading to an imbalance between TF and TFPI eventually. OSM might be related to thrombosis in patients with AF mediated by TF and TFPI PMID: 28471981 a novel STAT3/SMAD3-signaling axis is required for OSM-mediated senescence. PMID: 27892764 This result demonstrates that HPV16 oncoproteins upregulate oncostatin M and play an important role to promote oral squamous cell carcinoma development PMID: 27349249 The identification of the OSM inflammatory pathway as an important mediator of epithelial mesenchymal transition in triple-negative breast cancer (TNBC) may provide a novel potential opportunity to improve therapeutic strategies. PMID: 28106823 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. PMID: 26198770 Oncostatin M can regulate airway smooth muscle responses alone or in synergy with IL-17A. PMID: 25849622 we demonstrated that recombinant human OSM (rhOSM) promoted tumor angiogenesis in EC cell lines by activating STAT3 (signal transducer and activator of transcription 3) and enhanced both cell migration and cell inva PMID: 25954856 OSM expression in osteoblasts increases in response to Osteopontin-induced inflammation in vitro. PMID: 26304992 Data suggest that OSM promotes osteoblastic differentiation of vascular smooth muscle cells through JAK3/STAT3 pathway and may contribute to the development of atherosclerotic calcification. PMID: 25735629 administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation PMID: 26355153 OSM promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease. PMID: 25840724 Oncostatin M regulates neuronal function and confers neuroprotectin in an animal model of ischemic stroke. PMID: 26311783 In patients with diabetes, bone marrow plasma OSM levels were higher and correlated with the bone marrow to peripheral blood stem cell ratio. PMID: 25804939 OSM promotes STAT3-dependent intestinal epithelial cell proliferation and wound healing in vitro. PMID: 24710357 Autocrine activation of STAT3 in MCF-7 cells ectopically expressing OSM-induced cellular scattering. PMID: 25252914 oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells. PMID: 24418171 Data indicate that pro-inflammatory cytokines such as IL6 or OSM could activate pathways associated with prostate cancer progression and synergize with cell-autonomous oncogenic events to promote aggressive malignancy. PMID: 23867565 OSM may promote a clinically relevant EMT/CSC-like phenotype in human breast cancer via a PI3K-dependent mechanism PMID: 23584474 white adipose tissue macrophages are a source of OSM and OSM levels are significantly induced in obesity/type 2 diabetes. OSM produced from immune cells in WAT may act in a paracrine manner on adipocytes to promote inflammation in adipose tissue. PMID: 24297795 data suggest that increased serum OSM levels are associated with the coronary stenosis score and that circulating levels of this chemokine may reflect the extent of coronary atherosclerosis PMID: 24600984 TGFBI and periostin, extracellular matrix proteins implicated in tumorigenesis and metastasis, were identified as oncostatin M-induced secreted proteins in mesenchymal stem cells. PMID: 23735324 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia. PMID: 23621172 These data show that OSM and IL-1beta are not only a biological characteristic signature of hypertensive leg ulcer, but these cytokines reflect a specific inflammatory state, directly involved in the pathogenesis. PMID: 23313749 OSM induced proliferation of Ewing sarcoma cell lines. PMID: 22982441 Data suggest that OSM enhances invasion activities of extravillous trophoblasts during placentation through increased enzyme activity of MMP-2 (primarily) and MMP-9 (to some extent). PMID: 22931588 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor. PMID: 22829597 Oncostatin M signaling may cause suppression of estrogen receptor-alpha and disease progression i breast cancer. PMID: 22267707 Oncostatin M (OSM), a cytokine of the IL-6 family, was identified as a major coupling factor produced by activated circulating CD14+ or bone marrow CD11b+ monocytes/macrophages. PMID: 22267310 Oncostatin M (OSM) is a major mediator of cardiomyocyte dedifferentiation and remodeling during acute myocardial infarction (MI) and in chronic dilated cardiomyopathy (DCM). PMID: 22056139 JAK2 V617F-mediated up-regulation of OSM may contribute to fibrosis, neoangiogenesis, and the cytokine storm observed in myeloproliferative neoplasms. PMID: 22051730 c-MYC is an important molecular switch that alters the cellular response to OSM-mediated signaling from tumor suppressive to tumor promoting. PMID: 21975934 A possible interaction between IL-6, OSM, u-PA and VEGF in prostate cancer was investigated. PMID: 21965736 This report uses an in vitro model with human umbilical vein endothelial cells and isolated human neutrophils to examine the effects of two locally derived cytokines, granulocyte-macrophage colony-stimulating factor and G-CSF, on oncostatin M expression. PMID: 21775705 OSM is expressed in atherosclerotic lesions and may contribute to the progression of atherosclerosis by promoting SMC proliferation, migration and extracellular matrix protein synthesis through the STAT pathway PMID: 21376322 Taken together, our data show that KIT D816V promotes expression of OSM through activation of STAT5. PMID: 21457934 The purpose of this study was to investigate the possible suppressive or stimulatory role of OSM in the ovarian cancer model of SKOV3 cells, as well as the involvement of the ERK1/2, p38 and STAT3 signaling pathways. PMID: 21399864 promotes STAT3 activation, VEGF production, and invasion in osteosarcoma cell lines PMID: 21481226 a cytokine-triggered regulatory network for PCSK9 expression that is linked to JAKs and the ERK signaling pathway PMID: 21196532

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.