Recombinant Human Oligodendrocyte Transcription Factor 1 (OLIG1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10472P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Oligodendrocyte Transcription Factor 1 (OLIG1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10472P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Oligodendrocyte Transcription Factor 1 (OLIG1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q8TAK6 |
| Target Symbol | OLIG1 |
| Synonyms | Basic domain helix loop helix protein class B 6; Basic domain helix loop helix protein class B6; BHLH B6; BHLHB 6; bHLHb6; bHLHe21; Class B basic helix-loop-helix protein 6; Class E basic helix-loop-helix protein 21; Olig 1; Olig1; OLIG1_HUMAN; Oligo 1; Oligo1; Oligodendrocyte lineage transcription factor 1; Oligodendrocyte specific bHLH transcription factor 1; Oligodendrocyte transcription factor 1 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ |
| Expression Range | 17-105aa |
| Protein Length | Partial |
| Mol. Weight | 11.1 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube. |
| Subcellular Location | Nucleus. |
| Database References | HGNC: 16983 OMIM: 606385 KEGG: hsa:116448 STRING: 9606.ENSP00000371785 UniGene: PMID: 28253550 |
