Recombinant Human Olfactory Receptor 7D4 (OR7D4) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-00533P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Olfactory Receptor 7D4 (OR7D4) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-00533P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Olfactory Receptor 7D4 (OR7D4) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8NG98 |
| Target Symbol | OR7D4 |
| Synonyms | (OR19-B)(Odorant receptor family subfamily D member 4RT)(Olfactory receptor OR19-7) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-KSI |
| Target Protein Sequence | LLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNI |
| Expression Range | 161-197aa |
| Protein Length | Partial |
| Mol. Weight | 19.5 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Odorant receptor. Selectively activated by androstenone and the related odorous steroid androstadienone. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | G-protein coupled receptor 1 family |
| Database References | HGNC: 8380 OMIM: 611538 KEGG: hsa:125958 STRING: 9606.ENSP00000310488 UniGene: PMID: 26072518 |
