Recombinant Human Nucleoside Diphosphate Kinase, Mitochondrial (NME4) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03940P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Nucleoside Diphosphate Kinase, Mitochondrial (NME4) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03940P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Nucleoside Diphosphate Kinase, Mitochondrial (NME4) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O00746 |
Target Symbol | NME4 |
Synonyms | metastatic inhibition factor NM23H4; mitochondrial; NDK; NDKM_HUMAN; NDP kinase; NDP kinase D; NDP kinase, mitochondrial; NDPK D; NDPKD; nm23 H4; nm23-H4; NM23D; NM23H4; Nm23M4; NME/NM23 nucleoside diphosphate kinase 4; NME4; Non metastatic cells 4 protein expressed in; Non metastatic protein 23, homolog 4; Nucleoside diphosphate kinase D; Nucleoside diphosphate kinase, mitochondrial; Nucleoside diphosphate kinase, mitochondrial |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
Expression Range | 1-187aa |
Protein Length | Full Length |
Mol. Weight | 44.3kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling. |
Subcellular Location | Mitochondrion intermembrane space; Peripheral membrane protein. Mitochondrion matrix. |
Protein Families | NDK family |
Database References | HGNC: 7852 OMIM: 601818 KEGG: hsa:4833 STRING: 9606.ENSP00000219479 UniGene: PMID: 26742431 |