Recombinant Human Nucleoside Diphosphate Kinase B (NME2) Protein (His&Myc)

Name: Recombinant Human Nucleoside Diphosphate Kinase B (NME2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-03920P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nucleoside Diphosphate Kinase B (NME2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P22392
Target Symbol	NME2
Synonyms	C myc purine binding transcription factor PUF; C myc transcription factor; C-myc purine-binding transcription factor PUF; epididymis secretory sperm binding protein Li 155an; HEL-S-155an; Histidine protein kinase NDKB; MGC111212; MGC2212; NDK B; NDKB; NDKB_HUMAN; NDP kinase B; NDPK B; NDPKB; NM23 H2; nm23-H2; NM23B; NME/NM23 nucleoside diphosphate kinase 2; nme2; Non metastatic cells 2; protein (NM23B) expressed in; non-metastatic cells 2; protein (NM23) expressed in; Nucleoside diphosphate kinase B; Nucleotide diphosphate kinase B; PUF
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Expression Range	2-152aa
Protein Length	Partial
Mol. Weight	24.2 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not. Exhibits histidine protein kinase activity.
Subcellular Location	Cytoplasm. Nucleus. Cell projection, lamellipodium. Cell projection, ruffle.
Protein Families	NDK family
Database References	HGNC: 7850 OMIM: 156491 KEGG: hsa:4831 STRING: 9606.ENSP00000376886 UniGene: Hs.463456
Tissue Specificity	Isoform 1 and isoform 3 are ubiquitously expressed.

Gene Functions References

Data suggest that NME2 participates in epigenetic repression of TERT expression via a mechanism that is dependent on interactions with G-quadruplex DNA; NME2 appears to interact with TERT promoter as NME2/REST/LSD1 complex. (NME2 = metastasis suppressor protein 2; TERT = telomerase reverse transcriptase; REST = RE1-silencing transcription factor; LSD1 = lysine specific demethylase 1) PMID: 28717007
Role of Interaction and Nucleoside Diphosphate Kinase B in Regulation of the Cystic Fibrosis Transmembrane Conductance Regulator Function by cAMP-Dependent Protein Kinase A PMID: 26950439
NME2 may have an inhibitory activity on the propagation and invasion of gastric cancer cells. PMID: 25700270
Regulatory functions of Nm23-H2 in tumorigenesis: insights from biochemical to clinical perspectives PMID: 25413836
Recent findings demonstrate NME2 presence at telomere ends, association with telomerase, and NME2's role in inhibition of telomerase activity in cancer cells PMID: 25547372
A novel mechanism of CARMA3 in lung cancer stemness and metastasis through the negative regulation of NME2 was identified. PMID: 25906011
NDPK-B and NDPK-D were shown to bind efficiently to liposomes mimicking plasma membrane and mitochondrial inner membrane PMID: 25010650
Patients whose MPM tissues expressed elevated mRNA levels of BIRC5, DSP, NME2, and THBS2 showed a statistically significant shorter overall survival. PMID: 25771974
The results demonstrate that reduced NME2 levels lead to transcriptional de-repression of vinculin and regulate lung cancer metastasis. PMID: 25249619
nucleoside diphosphate kinase B (NDPK-B), activates TRPV5 channel activity and Ca(2+) flux, and this activation requires histidine 711 in the carboxy-terminal tail of TRPV5. PMID: 24523290
NDPKB is required for VEGF-induced angiogenesis and contributes to the correct localization of VEGF receptor type 2 and VE-cadherin at the endothelial adherens junctions. PMID: 25147336
PuF may regulate the APP gene promoter PMID: 23368879
post-transcriptional up-regulation of the tumor antigen NME2 is a common and specific property of CML closely associated with Bcr-Abl activity PMID: 22251158
NM23-H2 expression enhances tumorigenicity. PMID: 22192927
further demonstrate that shNDPK-B is released into the circulation in immunocompromized mice carrying the human breast carcinoma cell MDA-MB- PMID: 20830314
Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator) PMID: 20864512
NM23-H2 protein expression in human leukemia cell lines is related to cellular lineage and differentiation stages. PMID: 12007505
The nucleotide-binding site of NM23-H2 plays a critical role in not only the NDP kinase reaction but also the reactions involving covalent DNA binding and DNA cleavage catalysis. PMID: 12009894
Nm23-H2 had a cytoplasmic and nuclear localization but was induced to translocate to the plasma membrane upon stimulation of thromboxane A2 receptor beta to show extensive co-localization with the receptor. PMID: 14976202
novel association of NM23-H2 with ERbeta and show for the first time its expression in vascular cells and demonstrate regulation of its expression and localization by estrogen PMID: 17272673
Thus, these results indicate the existence of a previously undiscovered mechanism by which NM23-H2 involves in the regulation of Diva-mediated apoptosis. PMID: 17532299
NM23-H2 as an estrogen receptor beta-associated protein may play an important role in modulating the response to endogenous and exogenous estrogens. PMID: 17964137
describe the identification of NM23-H2 as a novel HLA-A32-restricted TAA of CML cells and demonstrate the presence of specifically reactive T cells in a patient 5 years after transplantation PMID: 18496563
While hPLIC proteins are not ubiquitinated by HERC3, HERC5 plays an important role in ubiquitination of Nm23B. PMID: 18535780
data indicate that NM23H2 is a negative regulator of cellular proliferation stimulated by EGF- and Ras-mediated activation of the ERK pathway PMID: 19022560
Role of NM23-H2 in the regulation of cell shape and migration via Rho family GTPase signals is reported. PMID: 19381785
Data support the hypothesis that exogenous pDNA binds to cytoplasmic shuttle proteins NM23-H2 and Chx10, and is then translocated to the nucleus using the minimal import machinery. PMID: 19638341

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.