Recombinant Human Nuclear Transport Factor 2 (NUTF2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09197P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Nuclear Transport Factor 2 (NUTF2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09197P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Nuclear Transport Factor 2 (NUTF2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P61970 |
| Target Symbol | NUTF2 |
| Synonyms | NTF 2; NTF-2; NTF2; NTF2_HUMAN; Nuclear transport factor 2; Nutf2; Placental protein 15; PP15 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG |
| Expression Range | 1-127aa |
| Protein Length | Full Length |
| Mol. Weight | 41.5kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import. |
| Subcellular Location | Cytoplasm, cytosol. Nucleus outer membrane. Nucleus, nuclear pore complex. Nucleus inner membrane. Nucleus, nucleoplasm. |
| Database References | HGNC: 13722 OMIM: 605813 KEGG: hsa:10204 STRING: 9606.ENSP00000219169 UniGene: PMID: 29017749 |
