Recombinant Human Nuclear Receptor Subfamily 4 Group A Member 2 (NR4A2) Protein (His)

Name: Recombinant Human Nuclear Receptor Subfamily 4 Group A Member 2 (NR4A2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03346P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nuclear Receptor Subfamily 4 Group A Member 2 (NR4A2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P43354
Target Symbol	NR4A2
Synonyms	HZF 3; HZF3; Immediate-early response protein NOT; Intermediate early receptor protein; NGFI B/nur77 beta type transcription factor homolog; NOT; Nr4a2; NR4A2_HUMAN; nuclear receptor of T cells; nuclear receptor related 1; Nuclear receptor subfamily 4 group A member 2; Nur related protein 1 homolog; nur related protein-1; human homolog of; Nurr 1; Orphan nuclear receptor NR4A2; Orphan nuclear receptor NURR1; RNR 1; RNR1; T cell nuclear receptor NOT; T-cell nuclear receptor NOT; TINUR; Transcriptionally inducible nuclear receptor; Transcriptionally inducible nuclear receptor related ; Transcriptionally inducible nuclear receptor related 1; Transcriptionally-inducible nuclear receptor
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Expression Range	1-598aa
Protein Length	Full Length
Mol. Weight	68.6 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons.
Subcellular Location	Cytoplasm. Nucleus. Note=Mostly nuclear; oxidative stress promotes cytoplasmic localization.
Protein Families	Nuclear hormone receptor family, NR4 subfamily
Database References	HGNC: 7981 OMIM: 601828 KEGG: hsa:4929 STRING: 9606.ENSP00000344479 UniGene: PMID: 29738496 Data expand the understanding of the mechanism by which the NR4A2 nuclear receptor can facilitate DNA DSB repair. PMID: 28607006 An association was identified in a Mexican population between genotype and mRNA expression levels of NR4A2 in patients with Parkinson's disease. PMID: 28716280 miR-34 was identified as a direct negative regulator of NR4A2. A novel regulatory network linking p53, miR-34, and NR4A2 was revealed, in which p53 can overcome its inhibition by endogenous NR4A2 through upregulating miR-34. PMID: 27121375 Nurr1 was induced during intestinal regeneration after I/R injury. Nurr1 promoted proliferation of intestinal epithelial cells after H/R injury. Nurr1 inhibited p21 expression in a p53-independent manner. Nurr1 inhibited p21 gene transcription by binding to p21 promoter directly. PMID: 27553040 Our findings of a de novo deletion of NR4A2 in an individual with mild intellectual disability and prominent speech and language impairment provides further evidence for NR4A2 haploinsufficiency being causative for neurodevelopmental and particularly language phenotypes PMID: 28544326 NR4A sub-family of nuclear orphan receptors (Nor-1, Nurr-1 and Nur-77) may have a role in trophoblastic cell differentiation. PMID: 28808448 this study shows over-expression of NR4A2 mRNA in peripheral CD4+ T cells of Sjogren's syndrome patients PMID: 28621822 NR4A2 and NR4A3 are components of a downstream transcriptional response to PKA activation in the neutrophil, and that they positively regulate neutrophil survival and homeostasis. PMID: 28637666 Study found a marked down-regulated gene expression of the NR4A subfamily (NR4A1, NR4A2, and NR4A3) obtained from Parkinson's disease patients, but only a NR4A1 decrease in Alzheimer's disease patients compared to healthy controls. This study reports that the entire NR4A subfamily and not only NR4A2 could be systemically involved in Parkinson's disease. PMID: 27159982 show that unsaturated fatty acids also interact with the Nurr1 LBD, and solution NMR spectroscopy reveals the binding epitope of DHA at its putative ligand-binding pocket PMID: 27128111 NURR1 is an essential transcription factor for the differentiation, maturation, and maintenance of midbrain dopaminergic neurons. PMID: 26678495 Nurr1 overexpression exerts neuroprotective and anti-inflammatory roles via down-regulating CCL2 in both in vivo and in vitro Parkinson's disease models, contributing to developing mechanism-based and neuroprotective strategies against PD PMID: 27940361 In the PPI network, genes may be involved in Down syndrome (DS) by interacting with others, including nuclear receptor subfamily 4 group A member 2 (NR4A2)early growth response (EGR)2 and NR4A2EGR3. Therefore, RUNX1, NR4A2, EGR2, EGR3 and ID4 may be key genes associated with the pathogenesis of DS. PMID: 27667480 Our results suggest that NLK inhibits transcriptional activation of Nurr1 gene by impeding CBP's role as a co-activator of NF-kappaB and CREB in prostate cancer. PMID: 27036119 decreased expression levels of Nurr1 were associated with chronic inflammation and insulin resistance in patients with T2D. PMID: 26239742 The immunohistochemical, qRT-PCR and western blot analyses revealed that Nurr1 expression was increased in gastric cancer tissues compared with normal gastric tissue. PMID: 26022133 NR4A2 is a key factor in multiple diseases, such as inflammation, cancer and cardiovascular diseases. PMID: 25917081 A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M. PMID: 25809189 In this review, a concise overview of the current understanding of the important metabolic roles governed by NR4A members NR4A1, NR4A2 and NR4A3 including their participation in a number of diseases shall be provided PMID: 25089663 Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR. PMID: 26148973 Thus our data identify a previously unknown role for Nr4a2 in the regulation of macrophage polarization. PMID: 25953901 The results failed to reveal significant link between NR4A2 polymorphism and schizophrenia risk. [META-ANALYSIS] PMID: 25982322 Because the phosphorylation site mutants of NR4A2 cannot rescue the cell death-promoting activity, ASK1-p38 pathway-dependent phosphorylation and subsequent cytoplasmic translocation of NR4A2 may be required for oxidative stress-induced cell death. PMID: 25752609 gestational diabetes mellitus, but not pre-existing maternal obesity, associated with increased placental expression PMID: 25199433 NURR1 upregulation by tissue-type plasminogen activator during ischemic stroke is associated with endothelial dysfunction and inflammation. PMID: 25503547 High cytoplasmic expression of NR4A2 is a potential unfavorable prognostic factor for patients with nasopharyngeal carcinoma. PMID: 23803035 The AngII-NGFIB/NURR1 pathway controls HSD3B1 expression. PMID: 25092869 our data demonstrate that key midbrain dopamine regulators (Nurr1, Pitx3, and Lmx1a) play overlapping as well as distinct roles during neurogenesis and neurotransmitter phenotype determination of mDA neurons PMID: 24172139 The current review describes the role of two such factors, Nurr1 and engrailed, in differentiation, maturation, and in normal physiological functions including acquisition of neurotransmitter identity. PMID: 24685177 Data indicate that expression of Nurr1 was significantly induced by 1,1-bis(3'-indolyl)-1-(p-chlorophenyl methane) (DIM-D). PMID: 23950896 A novel role for the NR4A2 nuclear receptors as direct facilitators of nucleotide excision repair. PMID: 24223135 The results of this study suggest a protective and anti-inflammatory role of NR4A2 and TNFAIP3, both being under-regulated in monocytes and CD4 + T cells of MS patients PMID: 24852325 NR4A2 is regulated by gastrin and influences cellular responses of gastric adenocarcinoma cells. PMID: 24086717 High NR4A2 expression in gastric cancer cells confers chemoresistance, attenuates 5-fluorouracil-induced apoptosis, and predicts an unfavorable survival, especially for those who received chemotherapy. PMID: 23821160 Bioinformatic and deletion studies identified a 5' region of the TSP-1 promoter repressed by NR4A2 and proangiogenic transcription factors, including NF-kappaB and Ets1/2. PMID: 23933487 Nurr1 overexpression significantly increased the SIRT1 occupancy of the consensus elements for Nurr1 binding hTH promoter region. PMID: 23977047 NR4A nuclear receptors are involved in negative selection of thymocytes, Treg differentiation and the development of Ly6C monocytes. Nur77 and Nurr1 attenuate atherosclerosis in mice whereas NOR-1 aggravates vascular lesion formation. PMID: 24005216 High nurr1 is associated with progression of prostate cancer PMID: 23679312 in human melanoma HMV-II cells both CRF and Ucn1 regulate TRP1 gene expression via Nurr-1/Nur77 production, independent of pro-opiomelanocortin or alpha-melanocyte-stimulating hormone stimulation. PMID: 23416839 High expression of NR4A2 in CRC cells confers chemo-resistance, attenuates chemotherapeutics-induced apoptosis, and predicts unfavorable prognosis of colon cancer patients. PMID: 23809767 Recessive genotypes of rs1150143, rs1150144, rs834830, and rs707132 were associated with a worse sustained attention task performance in schizophrenic males, but not females. Males with the GGGTG haplotype had poorer performance. PMID: 22294735 NURR1 function presents a dichotomy in breast cancer etiology, in which NURR1 expression is associated with normal breast epithelial differentiation and efficacy of systemic cancer therapy. PMID: 23517088 PIASgamma fully represses Nurr1 transactivation through a direct interaction, independently of its E3-ligase activity PMID: 23358114 Collectively, our results suggest that NR4A2 may be a susceptibility gene for Parkinson's disease in the Chinese population PMID: 22827504 Nurr1 shuttling between the cytosol and nucleus is controlled by specific nuclear import and export signals PMID: 23283970 Nur-related receptor 1 gene polymorphisms are implicated in alcohol dependence in Mexican Americans PMID: 23066323 Data show altered adipose tissue expression of the NURR1 stress-responsive nuclear receptor in obesity, suggesting it may modulate pathogenic potential in humans. PMID: 22143616 Pin1 enhances the transcriptional activity of all three NR4A nuclear receptors and increases protein stability of Nur77 through inhibition of its ubiquitination. PMID: 22789442 analysis of Nurr1 gene expression in electrically-stimulated human MSCs and the induction of neurogenesis PMID: 22800541

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.