Recombinant Human Nuclear Receptor Subfamily 4 Group A Member 1 (NR4A1) Protein (His&Myc)

Name: Recombinant Human Nuclear Receptor Subfamily 4 Group A Member 1 (NR4A1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01107P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nuclear Receptor Subfamily 4 Group A Member 1 (NR4A1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P22736
Target Symbol	NR4A1
Synonyms	(Early response protein NAK1)(Nuclear hormone receptor NUR/77)(Nur77)(Orphan nuclear receptor HMR)(Orphan nuclear receptor TR3)(ST-59)(Testicular receptor 3)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Expression Range	1-598aa
Protein Length	Full Length
Mol. Weight	69.5 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation. Plays a role in the vascular response to injury.
Subcellular Location	Nucleus. Cytoplasm. Mitochondrion.
Protein Families	Nuclear hormone receptor family, NR4 subfamily
Database References	HGNC: 7980 OMIM: 139139 KEGG: hsa:3164 STRING: 9606.ENSP00000353427 UniGene: Hs.524430
Tissue Specificity	Fetal muscle and adult liver, brain and thyroid.

Gene Functions References

This study reveals a unique mechanism to suppress hepatocellular carcinoma by switching from glycolysis to gluconeogenesis through Nur77 antagonism of PEPCK1 degradation. PMID: 28240261
we show here that the BCR/BTK target gene NR4A1 is a potential oncogene in mantle cell lymphoma PMID: 29167454
this study confirmed that NR4A1 sensitizes gastric cancer cells to TNFalpha-induced apoptosis through the inhibition of JNK/Parkin-dependent mitophagy. PMID: 29207128
Inhibition of NR4A1 in stromal cells increased the TGF-beta1-dependent elevated expression of fibrotic markers, and loss of NR4A1 stimulated fibrogenesis in mice with endometriosis. PMID: 29669342
NR4A1 knockdown partly decreased surface NR2B by promoting NR2B internalization. PMID: 27876882
Data show that SUMOylation is critical in controlling NR4A1 function in inflammatory cytokine signaling and controlling macrophage cell death. PMID: 28622293
our findings suggest that hypoxia-induced down-regulation of TR3 might play an important role for hypoxia-induced apoptosis resistance in NSCLC. PMID: 28838387
Nur77 suppresses CD4(+) T cell proliferation and uncover a suppressive role for Irf4 in TH2 polarization; halving Irf4 gene-dosage leads to increases in GATA3(+) and IL-4(+) cells. PMID: 28538176
our data demonstrated that NR4A1 protein physically associates with the WT1 promoter, and enhanced WT1 promoter transactivation and knockdown of WT1 in MIN6 cells induced apoptosis. These findings suggest that NR4A1 protects pancreatic beta-cells against H2O2 mediated apoptosis by up-regulating WT1 expression. PMID: 28342843
NR4A modulates the decidualization of hESCs by upregulating prolactin (PRL) and insulin-like growth factor binding protein-1 (IGFBP-1) expression and transformation in vitro. PMID: 27515096
DNMT1 causes NR4A1 DNA hypermethylation and blocks insulin signaling in an Chinese patients with type 2 diabetes PMID: 27322146
Data show that nuclear receptor 4A1 (NR4A1) knockdown and the C-DIM/NR4A1 antagonists were comparable as inhibitors of NR4A1-dependent genes/pathways. PMID: 27144436
mRNAs expression and methylation pattern of RARB, NR4A1 and HSD3B2 genes in human adrenal tissues (HAT) and in pediatric virilizing adrenocortical tumors (VAT) were analyzed. PMID: 27670690
NR4A sub-family of nuclear orphan receptors (Nor-1, Nurr-1 and Nur-77) may have a role in trophoblastic cell differentiation. PMID: 28808448
beta1-integrin expression is regulated in pancreatic and colon cancer cells by the pro-oncogenic orphan nuclear receptor 4A1 PMID: 28418095
Inhibition of NR4A1-mediated transcriptional activity was involved in the anticancer effects of fangchinoline; fangchinoline represents a novel class of mechanism-based anticancer agents targeting NR4A1 that is overexpressed in pancreatic cancer. PMID: 28754437
Transcript analysis of four different aggressive lymphoma cell lines overexpressing either NR4A3 or NR4A1 revealed that apoptosis was driven similarly by induction of BAK, Puma, BIK, BIM, BID, and Trail. Overall, our results showed that NR4A3 possesses robust tumor suppressor functions of similar impact to NR4A1 in aggressive lymphomas PMID: 28249906
NR4A1 expression is specific to a quiescent subset of T-cells. PMID: 27617863
we demonstrate that endogenous Nur77 protein expression can serve as a reporter of T-cell receptor and B-cell receptor specific signaling in human peripheral blood mononuclear cells. PMID: 27940659
we report overexpression of the nuclear receptor NR4A1 in rhabdomyosarcomas that is sufficient to drive high expression of PAX3-FOXO1A PMID: 27864345
Study found a marked down-regulated gene expression of the NR4A subfamily (NR4A1, NR4A2, and NR4A3) obtained from Parkinson's disease patients, but only a NR4A1 decrease in Alzheimer's disease patients compared to healthy controls. This study reports that the entire NR4A subfamily and not only NR4A2 could be systemically involved in Parkinson's disease. PMID: 27159982
Nur77 overexpression prevented pulmonary artery smooth muscle cells from proliferation and migration; Nur77 is an important mediator of hypoxia-induced pulmonary vascular remodeling in pulmonary hypertension PMID: 27871853
Data show Kruppel-like factor 12 (KLF12) impairs endometrial decidualization by transcriptionally repressing Nur77 protein, and Nur77 overexpression reverses the poor decidual response of endometrial stromal cells (hESCs) in recurrent implantation failure (RIF) patients. PMID: 28359310
Nur77 decreases ET-1 expression by suppressing NF-kappaB and p38 MAPK. PMID: 27765761
NR4A1 is highly expressed in a subset of HGSOC samples from patients that have a worse progression free survival. PMID: 26946093
Nur77 gene expression levels might involve different autonomy of ACTH production between Cushing disease (CD) and subCD. PMID: 27025408
Data show that three TR3 orphan nuclear receptor (TR3) transcript variant messenger RNAs (mRNAs) are expressed in human umbilical vein endothelial cell (HUVEC) and are differentially regulated by vascular endothelial growth factor (VEGF). PMID: 26440050
Mutagenesis of residues lining the identified interaction site on Bcl-B negated the interaction with Nur77 protein in cells and prevented Nur77-mediated modulation of apoptosis and autophagy PMID: 27129202
NR4A1 regulates beta1-integrin expression and beta1-integrin-dependent migration of breast cancer cells, and this is accompanied by decreased expression of beta3-integrin. PMID: 26929200
Data indicate that N-myc downstream regulated gene 1 (NDRG1) competitively bind to glycogen synthase kinase 3beta (GSK-3beta) and orphan nuclear receptor (Nur77) to prevent beta-catenin degradation. PMID: 26359353
analysis of amino acid fragments required by TR3/Nur77 for its functions in angiogenesis PMID: 26155943
The results demonstrate that Nur77 is induced by oxLDL via the p38 MAPK signaling pathway, which is involved in the regulation of cell survival. Nur77 enhanced cell survival via suppressing apoptosis, without affecting cell proliferation of activated macrophages, which may be beneficial in patients with atherosclerosis. PMID: 26768365
NR4As regulate gene transcription primarily through interaction with distal enhancers that are co-enriched for NR4A1 and ETS transcription factor motifs PMID: 26938745
miR-124 to be downregulated in instances of medulloblastoma in which Nur77 is upregulated, resulting in a proliferative state that abets cancer progression. PMID: 26840408
ApoA-IV colocalizes with NR4A1, which suppresses G6Pase and PEPCK gene expression at the transcriptional level, reducing hepatic glucose output and lowering blood glucose. PMID: 26556724
NR4A1 is a key factor in multiple diseases, such as arthritis, inflammation, cancer and cardiovascular diseases. PMID: 25917081
Identified Nur77/Nor1 as novel regulators of thrombomodulin expression and function in vascular endothelial cells. PMID: 26634653
The results found that genetic variants of the NUR77 gene are associated with increased risk for both UC and CD PMID: 26564988
High NR4A1 expression is associated with breast cancer. PMID: 26229035
Molecular dynamics simulation results of NR4A1 reveal a pronounced pocket that binds the known ligands which is similar to known nucleotide-binding sites. Its molecular conformation can be affected by alternate-site modulators. PMID: 26270486
Studied the expression and function of TR3 in skin. Also studied the function of TR3 in the effect of androgens in keratinocytes by treating HaCaT keratinocytes and primary human keratinocytes with dihydrotestosterone (DHT) and testosterone (T). PMID: 26707825
Nur77 protein is expressed in colon tissues from Crohn's disease and ulcerative colitis. Nur77 also strongly decreased expression of MCP-1, CXCL1, IL-8, MIP-1alpha and TNFalpha in gut epithelial Caco-2 cells. PMID: 26241646
High NR4A1 expression is associated with Renal Cell Adenocarcinoma. PMID: 26035713
in hepatocytes, HCV core protein increases drug resistance and inhibits cell apoptosis by inhibiting the expressions of NR4A1 and RUNX3 PMID: 26392314
Results show that Nur77 was overexpressed in high percentage of human colon and liver cancer, and the intracellular location of Nur77 correlated with elevated serum total Bile acids levels in patients with colon cancer. PMID: 25232032
A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M. PMID: 25809189
In this review, a concise overview of the current understanding of the important metabolic roles governed by NR4A members NR4A1, NR4A2 and NR4A3 including their participation in a number of diseases shall be provided PMID: 25089663
Data show that some rexinoids display selective coactivator (CoA) recruitment by the retinoid X receptors (RXRs) homodimer and by the heterodimers nuclear receptor Nur77/RXR and Nurr1/RXR. PMID: 26148973
Histone acetylation contributes to the regulation of NR4A1 expression in hypercholesterolaemia, and that NR4A1 expression reduces hypercholesterolaemia-induced inflammation. PMID: 26396259
Whereas NR4A1, induced by PDGF-BB, suppresses cell growth on a solid surface, it increases anchorage-independent growth. PMID: 25269081

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.