Recombinant Human Nuclear Receptor Subfamily 1 Group I Member 2 (NR1I2) Protein (His-SUMO&Myc)

Name: Recombinant Human Nuclear Receptor Subfamily 1 Group I Member 2 (NR1I2) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-02785P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NR1I2.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nuclear Receptor Subfamily 1 Group I Member 2 (NR1I2) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O75469
Target Symbol	NR1I2
Synonyms	BXR; Nr1i2; NR1I2_HUMAN; Nuclear receptor subfamily 1 group I member 2; ONR 1; ONR1; Orphan nuclear receptor PAR 1; Orphan nuclear receptor PAR1; Orphan nuclear receptor PXR; OTTHUMP00000215173; OTTHUMP00000215174; OTTHUMP00000215175; PAR 1; PAR 2; PAR; PAR q; PAR1; PAR2; PARq; pregnane X nuclear receptor variant 2; Pregnane X receptor; PRR; PXR; SAR; Steroid and xenobiotic receptor; SXR
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Expression Range	1-434aa
Protein Length	Full Length
Mol. Weight	69.8kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Subcellular Location	Nucleus.
Protein Families	Nuclear hormone receptor family, NR1 subfamily
Database References	HGNC: 7968 OMIM: 603065 KEGG: hsa:8856 STRING: 9606.ENSP00000336528 UniGene: Hs.7303
Tissue Specificity	Expressed in liver, colon and small intestine.

Gene Functions References

EGF suppresses specifically CAR signaling mainly through transcriptional regulation and drives the xenobiotic response toward a pregnane X receptor (PXR)-mediated mechanism. PMID: 29269410
The bosutinib C0 in patients with the NR1I2 7635G/G or 8055T/T genotype was significantly lower than those in patients with the 7635A allele or 8055C allele. PMID: 29736778
An overview of NR1I2 and NR1I3 pharmacogenetic studies in various therapeutic fields. PMID: 29199543
The pregnane X receptor (PXR) and the nuclear receptor corepressor 2 (NCoR2) modulate cell growth in head and neck squamous cell carcinoma. PMID: 29470550
High endogenous pregnane X receptor (PXR) level is associated with poor sorafenib therapy outcome. PMID: 29369785
A total of six studies with 4248 cases and 3853 controls were included in this meta-analysis. Three PXR gene polymorphisms were evaluated: rs1523127, rs2276707, and rs6785049. Our analyses of rs1523127, rs2276707, and rs6785049 suggested that PXR gene polymorphism had no obvious influence on the risk of inflammatory bowel disease in Caucasians. PMID: 28742404
genotypes and haplotypes of PXR rs3814057, rs3814058 and rs6785049 have impact on the major adverse cardiovascular events in clopidogrel treated patients after percutaneous coronary intervention PMID: 29432831
NR1I2 has a role in promoting stem cell-mediated colon cancer relapse PMID: 27448961
Dual ligands of CAR/PXR show distinct gene regulation patterns by regulating cross-talk between CAR and PXR. PMID: 27197997
High PXR expression is associated with multidrug resistance in breast cancer. PMID: 26934120
PXR, CYP3A4, and VIL1 expression was decreased only in the actively inflamed small intestinal tissue in children with Crohn's disease. PMID: 27013401
NR1I2 g.7635A>G had a significant interaction with time, but the dose-adjusted tacrolimus concentration did not significantly differ over 5 years post-transplantation, except for the GG genotype of NR1I2 g.7635A>G. PMID: 28945481
Together, our results suggest that protection of the endothelial barrier by APC/TR47-mediated signaling pathways might be a valuable therapeutic approach to prevent metastasis PMID: 29196264
Mulberroside A significantly suppressed PXR-mediated P-gp luciferase activity induced by rifampicin (Rif). PMID: 27918128
This data indicates that 14-3-3sigma contributes to P-gp overexpression through interaction with PXR with rifampin and paclitaxel treatment. PMID: 28077325
Data suggest both PXR and CAR are expressed in testis/Sertoli cells; exposure of Sertoli cells (in vitro model of blood-testis barrier) to PXR or CAR ligands (including antiretroviral drugs) up-regulates expression of Pgp/ABCB1, BCRP, and MRP4. (PXR = pregnane X receptor; CAR = constitutive androstane receptor; Pgp/ABCB1 = P-glycoprotein ABCB1; BCRP = breast cancer resistance protein; MRP4 =multidrug resistance protein 4) PMID: 28970358
Genetic variations in PXR affect induction of Bupropion hydroxylation by sodium ferulate. PMID: 23840296
This study revealed for the first time the involvement of NR1I2 in the pharmacogenetics of irinotecan and suggest that it may help to predict the toxicity of low-dose irinotecan. PMID: 27116457
In intrahepatic cholestasis of pregnancy, gene silencing of miR-148a upregulated PXR expression which was inhibited by estradiol in liver cells. miR-148a may be involved in the estrogen induction in ICP via PXR signaling. MRP3 may be involved. PMID: 28575098
this study shows that PXR augments Mycobacterium tuberculosis survival inside the host macrophages by promoting the foamy macrophage formation and abrogating phagolysosomal fusion, inflammation, and apoptosis PMID: 27233963
This is the first time an association between NR1I2 polymorphism and time of progression to AIDS is reported and supports an apparent relationship between the gene in the immune response and identifies another genetic factor influencing AIDS progression. PMID: 28327790
MD simulations further revealed that the presence of small molecule at allosteric site disrupts the LBD dynamics and locks the LBD in a "tightly-contracted" conformation. The molecular details provided here could guide new structural studies to understand PXR activation and antagonism. PMID: 27515410
Extracellular granzyme K mediates endothelial activation through the cleavage of PAR-1. PMID: 26936634
Pregnane X receptor interacts with liver X receptor to regulate expression of SMPDL3A in primary hepatocytes. PMID: 28414139
66034T/C polymorphism of the human pregnane X receptor (hPXR) is potential risk factor for drug-resistant epilepsy. PMID: 27836114
The data suggest that some of the natural PXR variants may have adverse physiological consequences owing to its influence on the expression levels and functional output of drug-metabolizing enzymes and transporters. PMID: 26962022
miR-30c-1-3p was shown to alter the expression of CYP3A4, a prototypical target gene of PXR. PMID: 27085140
The nuclear receptor PXR regulates hepatic energy metabolism. (Review) PMID: 27041449
Novel functions of PXR in cardiometabolic disease development have been described. (Review) PMID: 26924429
Acetylation of lysine 109 modulates PXR DNA binding and transcriptional activity; PXR acetylation status and transcriptional activity are modulated by E1A binding protein (p300) and SIRT1. PMID: 26855179
Genome-wide comparison of the inducible transcriptomes of nuclear receptors CAR, PXR and PPARalpha in primary human hepatocytes has been presented. PMID: 26994748
PXR regulates the intestinal epithelial barrier during inflammation by modulating cytokine-induced MLCK expression and JNK1/2 activation PMID: 27440420
The polymorphism frequency of PXR11156A; C/11193 T; C and 8055C; T were 49.6 and 49.3%, and the rate of PXR (*) 1B haplotype was 48.8%. None of the pain scores, consumption of fentanyl 24 h post-operatively or enzyme activity of CYP3A4, showed differences among different genotypes. PMID: 27876007
FGF21-PXR signaling pathway may be involved in decreased hepatic CYP3A4 metabolic activity in Nonalcoholic fatty liver disease. PMID: 27482056
the -831C/T polymorphism has a direct effect on transcriptional regulation of PXR gene. PMID: 28198586
These findings demonstrated that rifaximin causes PXR-mediated inhibition of angiogenic factors in Caco-2 cell line and may be a promising anticancer tool. PMID: 27279570
rs3842689, 7635G>A (rs6785049), and 24381C>A (rs1523127) PXR polymorphisms have no obvious impact on FK506; furthermore, the PXR rs3842689 wild-type homozygous WW genotype is a risk factor of FK506 and results in gastrointestinal reactions. PMID: 27706725
The agonistic effects of two new flame retardants on PXR expression and activity are reported. PMID: 27506419
Identify sixteen novel structurally different PXR activators capable of inducing CYP3A4 expression in HepG2 cells. PMID: 25455453
suPAR is a useful surrogate biomarker for development of multiple organ dysfunction and severe sepsis after multiple traumas. PMID: 27121128
result suggests that in Indonesian patients with tuberculosis, the risk of having antituberculosis drug-induced liver injury was associated with TT genotype of the PXR gene PMID: 26417664
EPAS-1 and PXR may cooperatively participate in development and especially MDR process of stomach cancer PMID: 26783937
Reported is the distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, and European populations of Brazil and their association with predisposition to cancer. PMID: 26879815
We found that ARRDC3 is required for ALIX ubiquitination induced by activation of PAR1 PMID: 26490116
hPXR is regulated through its phosphorylation at threonine-408 by PKC, CHIP/chaperone-dependent stability check, and autophagic degradation pathway. PMID: 26534988
we have identified novel PXR dependent pathways in human de novo lipogenesis, which may participate in hepatic steatosis and pathogenesis of steatohepatitis PMID: 25182422
Role of NR1I2 polymorphisms in head and neck squamous cell carcinoma PMID: 26141049
Our results revealed that PXR could be a determinant of stable warfarin doses. PMID: 25848132
Carriers of two copies of the ATG haplotypes of NR1I2-rs1523130, rs3814055 and rs1523127 were less sensitive to thrombocytopenia than those harboring other haplotypes PMID: 26267044
Genotyping of CYP3A4/MDR1/NR1I2 polymorphisms may be helpful for better guiding tacrolimus dosing in CYP3A5 nonexpressers. PMID: 26228923

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.