Recombinant Human Nuclear Receptor Ror-Alpha (RORA) Protein (His)

Beta LifeScience SKU/CAT #: BLC-11114P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Nuclear Receptor Ror-Alpha (RORA) Protein (His)

Beta LifeScience SKU/CAT #: BLC-11114P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Nuclear Receptor Ror-Alpha (RORA) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P35398
Target Symbol RORA
Synonyms fhl2a; NR1F1; Nuclear receptor ROR alpha; Nuclear receptor ROR-alpha; Nuclear receptor RZR-alpha; Nuclear receptor subfamily 1 group F member 1; RAR related orphan receptor A; RAR related orphan receptor alpha; RAR-related orphan receptor A; Retinoid-related orphan receptor-alpha; Rora; RORA_HUMAN; RZR alpha; RZR-ALPHA; RZRA; Transcription factor RZR alpha
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence GETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Expression Range 262-523aa
Protein Length Partial
Mol. Weight 35.4
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of embryonic development, cellular differentiation, immunity, circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target genes regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates genes involved in photoreceptor development including OPN1SW, OPN1SM and ARR3 and skeletal muscle development with MYOD1. Required for proper cerebellum development. Regulates SHH gene expression, among others, to induce granule cells proliferation as well as expression of genes involved in calcium-mediated signal transduction. Regulates the circadian expression of several clock genes, including CLOCK, ARNTL/BMAL1, NPAS2 and CRY1. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORA-mediated activation of clock genes expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Regulates genes involved in lipid metabolism such as apolipoproteins APOA1, APOA5, APOC3 and PPARG. In liver, has specific and redundant functions with RORC as positive or negative modulator of expression of genes encoding phase I and phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as CYP7B1 and SULT2A1. Induces a rhythmic expression of some of these genes. In addition, interplays functionally with NR1H2 and NR1H3 for the regulation of genes involved in cholesterol metabolism. Also involved in the regulation of hepatic glucose metabolism through the modulation of G6PC1 and PCK1. In adipose tissue, plays a role as negative regulator of adipocyte differentiation, probably acting through dual mechanisms. May suppress CEBPB-dependent adipogenesis through direct interaction and PPARG-dependent adipogenesis through competition for DNA-binding. Downstream of IL6 and TGFB and synergistically with RORC isoform 2, is implicated in the lineage specification of uncommitted CD4(+) T-helper (T(H)) cells into T(H)17 cells, antagonizing the T(H)1 program. Probably regulates IL17 and IL17F expression on T(H) by binding to the essential enhancer conserved non-coding sequence 2 (CNS2) in the IL17-IL17F locus. Involved in hypoxia signaling by interacting with and activating the transcriptional activity of HIF1A. May inhibit cell growth in response to cellular stress. May exert an anti-inflammatory role by inducing CHUK expression and inhibiting NF-kappa-B signaling.
Subcellular Location Nucleus.
Protein Families Nuclear hormone receptor family, NR1 subfamily
Database References

HGNC: 10258

OMIM: 600825

KEGG: hsa:6095

STRING: 9606.ENSP00000261523

UniGene: PMID: 29656859

  • We have identified RORalpha as a regulator of Treg genes responsible for suppressing allergic skin inflammation and also documented higher expression of RORalpha in skin-resident Tregs than in peripheral blood circulating Tregs in humans, suggesting that RORalpha and the TL1A-DR3 circuit could be therapeutically targeted in atopic dermatitis. PMID: 29500225
  • RORA downregulation may be a potential indicator of positive response to interferon beta treatment of multiple sclerosis patients PMID: 29889063
  • In the present study we have detected an association between rs4774388 genotype and breast cancer risk in a population of Iranian breast cancer patients. PMID: 28598825
  • rs4774388-TT genotype was significantly higher in patients compared with controls and was associated with autism spectrum disorder risk in dominant inheritance model PMID: 28608249
  • human melanoma development and aggressiveness is associated with decreased expression of RORalpha and RORgamma, suggesting that RORs could be important in melanoma progression and host responses against the tumor PMID: 27542227
  • CYP11A1- derived hydroxyvitamin D derivatives as "inverse" agonists on ROR-alpha and ROR-gamma. PMID: 27693422
  • The expression RORalpha is significantly elevated under hypoxic conditions in keratinocytes in an HIF-1alpha dependent manner. PMID: 28332183
  • RORgammat and RORalpha have overlapping roles in human Th17 cell differentiation through regulation of a defined common set of Th17 genes PMID: 28763457
  • Retinoid-related orphan receptor alpha-regulated development of the mouse cerebellum has a distinct critical period for (1) lengthening Purkinje cell (PC) primary dendrite stems and the eventual increase in the thickness of the molecular layer and (2) the establishment of mGluR signaling and associated removal of surplus climbing fibers from PCs. PMID: 26122696
  • findings strongly suggest that CLDND1 is a direct RORalpha target PMID: 28130419
  • TRIB3 promotes acute promyelocytic leukemia progression through stabilization of the oncoprotein PML-RARalpha and inhibition of p53-mediated senescence. PMID: 28486108
  • the RAR-related orphan receptor-a gene (RORA) and the Peroxisome Proliferator-Activated Receptor Gamma, Coactivator 1 Alpha gene (PPARGC1A or PGC-1alpha) were significantly associated with the Li response. Our results suggest genetic associations between Li response and these two close biological partners: PPARGC1A and RORA involved in circadian rhythms and bioenergetics processes in Li response PMID: 27324142
  • The present study is to determine if any relation exists between RORA rs11639084 and rs4774388 gene polymorphisms on the individual susceptibility of multiple sclerosis. PMID: 27653902
  • ROR-alpha may regulate signaling receptor activity, and transmembrane transport activity through its potential target genes. PMID: 28238834
  • Association between RORA gene polymorphisms and the DSM-5 posttraumatic stress disorder symptoms in male earthquake survivors in China. PMID: 28262136
  • this animal model study suggests that the NR, RORalpha4, has a critical regulatory role in the phenotype associated with decreased subcutaneous fat deposition, fatty liver and impaired glucose tolerance. PMID: 27568222
  • The RORA intronic SNP rs11632098 was associated with greater odds of reporting depressive symptoms in older adults. PMID: 25892098
  • A common SNP in the RORA gene (rs2899663) was associated with a 21% reduced odds of placental abruption. PMID: 26515929
  • status epilepticus induced by pilocarpine is able to change the expression and daily variation of RORalpha in the rat hippocampal area during the acute and silent phases PMID: 26731717
  • In a Han Chinese population, an association between RORA gene variation and depression personality trait was found. PMID: 26184991
  • associations between NR1D1, RORA and RORB genes and bipolar disorder.( PMID: 25789810
  • Retinoid-related orphan receptor alpha has gained attention as a new candidate in stress-related disorders, especially depression. PMID: 25826113
  • Identify RORalpha as being essential to drive inflammation in experimental epidermolysis bullosa acquisita. PMID: 25953430
  • the data presented in this report are that RORA is linked in important ways to molecules that could be playing important roles in the AD etiology. PMID: 25362032
  • Retinoic acid receptor-related orphan receptor-alpha (RORalpha) may be a potential risk gene for chronic obstructive pulmonary disease (COPD). PMID: 24943193
  • RORA variants were associated with dyslipidemia and obesity in Mexicans. PMID: 24886709
  • RORA rs12912233 alone might be a possible risk variant for epilepsy in Malaysian Chinese, but that, together with RORA rs880626 and SCN1A rs3812718, this polymorphism may have a synergistic effect in the epilepsy risk in Malaysians. PMID: 25668517
  • A cluster of RORA SNPs around rs2083074 showed an effect on psychic adverse drug reactions in the bipolar disorder. PMID: 25129258
  • This information suggests that RORalpha is a potent tumor suppressor and a potential therapeutic target for breast cancer. PMID: 23443091
  • RORalpha and its target gene expressions are lower in colorectal tumor tissue compared with control colorectal tissue. PMID: 25500738
  • RORalpha mediates reprogramming of glucose metabolism in hepatoma cells in response to glutamine deficiency. PMID: 25346526
  • TIMELESS and RORA genes may confer susceptibility to bipolar disorders and impact on circadian phenotypes PMID: 24716566
  • Two single nucleotide polymorphisms in RORA were associated with breast cancer in the whole sample and among postmenopausal women, and we also reported an association with CLOCK, RORA, and NPAS2 in the analyses at the gene level PMID: 24919398
  • down-regulated RORalpha expression was associated with poorer prognosis in HCC patients. PMID: 24798975
  • Data indicate that intellectual disability and epilepsy are frequently observed with 15q22.2 deletions including the NMDA receptor-regulated 2 gene (NARG2) and the PAR-related orphan receptor A gene (RORA). PMID: 24525055
  • These results reveal a novel link between ROR-alpha and E2F1 in regulating cell cycle progression and mammary tissue morphogenesis. PMID: 24891616
  • 20(OH)D3 and 20,23(OH)2D3 act as antagonists or inverse agonists of RORalpha and RORgamma. PMID: 24668754
  • The retinoid-related orphan receptor RORalpha promotes keratinocyte differentiation via FOXN1. PMID: 23922987
  • RORA genotype predicted circadian rhythm period lengthening by lithium, specifically among bipolar disorder cases. PMID: 24150227
  • DSG1, DSG3 and RORA values of the study group were not statistically different from control group (p > 0.05). PMID: 24142618
  • found an association at genome-wide levels of significance between PTSD and the retinoic acid orphan receptor alpha. receptor A (RORA) gene PMID: 22869035
  • Deficiency of RORalpha caused a damped transcriptional oscillation of Npas2 in NIH 3T3 cells. PMID: 24196956
  • RORalpha is a key regulator of diurnal rhythm and fasting induction of CYP8B1, which regulates bile acid composition and serum and liver cholesterol levels. PMID: 24226095
  • this study reveals a novel RORalpha-dependent escape mechanism by which H5N1 prevents an effective inflammatory response of monocytes blocking NF-kappaB-dependent gene expression. PMID: 23445660
  • RORA SNPs are associated with childhood asthma and show epistasis with NPSR1, and the interaction between RORA and NPSR1 may be of biological relevance. PMID: 23565190
  • RORA expression was downregulated in colorectal adenocarcinomas compared to normal controls and correlated with time to disease progression PMID: 22104449
  • SULT2A1 as a novel ROR-alpha and ROR-gamma target gene. PMID: 23211525
  • the results of this study indicate that cholesterol sulfate induces filaggrin expression through increased RORalpha expression. PMID: 23063684
  • Genetic variants of RORA associate with depressive disorder and bipolar disorder. PMID: 22538398
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed