Recombinant Human Nuclear Pore Membrane Glycoprotein 210 (NUP210) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04496P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Nuclear Pore Membrane Glycoprotein 210 (NUP210) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04496P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Nuclear Pore Membrane Glycoprotein 210 (NUP210) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8TEM1 |
| Target Symbol | NUP210 |
| Synonyms | FLJ22389; GP 210; KIAA0906; Nuclear envelope pore membrane protein POM 210; Nuclear pore membrane glycoprotein 210; Nuclear pore protein gp210; Nucleoporin 210; Nucleoporin 210kDa; Nucleoporin Nup210; Nucleoporin210; NUP 210; Nup210; PO210_HUMAN; POM 210; POM210; Pore membrane protein of 210 kDa |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ |
| Expression Range | 1529-1808aa |
| Protein Length | Partial |
| Mol. Weight | 34.5kDa |
| Research Area | Transport |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. |
| Subcellular Location | Nucleus, nuclear pore complex. Nucleus membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. |
| Protein Families | NUP210 family |
| Database References | HGNC: 30052 OMIM: 607703 KEGG: hsa:23225 STRING: 9606.ENSP00000254508 UniGene: PMID: 12653556 |
