Recombinant Human Nuclear Inhibitor Of Protein Phosphatase 1 (PPP1R8) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08881P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Nuclear Inhibitor Of Protein Phosphatase 1 (PPP1R8) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08881P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Nuclear Inhibitor Of Protein Phosphatase 1 (PPP1R8) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q12972 |
| Target Symbol | PPP1R8 |
| Synonyms | Activator of RNA decay; ARD 1; ARD-1; ARD1; Homolog of E.coli RNase E; NIPP 1; NIPP-1; NIPP1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; Nuclear subunit of PP1; PP1R8_HUMAN; PPP1R8; PRO2047 ; Protein phosphatase 1 regulatory inhibitor subunit 8; Protein phosphatase 1 regulatory subunit 8; RNase E; RNase E, E. coli, homolog of |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG |
| Expression Range | 1-209aa |
| Protein Length | Full Length of Isoform 2 |
| Mol. Weight | 52.1kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.; Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing. |
| Subcellular Location | Nucleus. Nucleus speckle. Note=Primarily, but not exclusively, nuclear.; [Isoform Gamma]: Cytoplasm. Note=Found mainly in the cytoplasm. |
| Database References | HGNC: 9296 OMIM: 602636 KEGG: hsa:5511 STRING: 9606.ENSP00000311677 UniGene: PMID: 27644248 |
