Recombinant Human Nuclear Inhibitor Of Protein Phosphatase 1 (PPP1R8) Protein (GST)

Name: Recombinant Human Nuclear Inhibitor Of Protein Phosphatase 1 (PPP1R8) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08881P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nuclear Inhibitor Of Protein Phosphatase 1 (PPP1R8) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q12972
Target Symbol	PPP1R8
Synonyms	Activator of RNA decay; ARD 1; ARD-1; ARD1; Homolog of E.coli RNase E; NIPP 1; NIPP-1; NIPP1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; Nuclear subunit of PP1; PP1R8_HUMAN; PPP1R8; PRO2047 ; Protein phosphatase 1 regulatory inhibitor subunit 8; Protein phosphatase 1 regulatory subunit 8; RNase E; RNase E, E. coli, homolog of
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG
Expression Range	1-209aa
Protein Length	Full Length of Isoform 2
Mol. Weight	52.1kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.; Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.
Subcellular Location	Nucleus. Nucleus speckle. Note=Primarily, but not exclusively, nuclear.; [Isoform Gamma]: Cytoplasm. Note=Found mainly in the cytoplasm.
Database References	HGNC: 9296 OMIM: 602636 KEGG: hsa:5511 STRING: 9606.ENSP00000311677 UniGene: PMID: 27644248 Data suggest overexpression of NIPP1 in HeLa cells causes induction of genes of mesenchymal lineage with reduction in cell proliferation; thus, key dephosphorylation events may be involved in epithelial-mesenchymal transition or transdifferentiation. PMID: 25907536 The protein phosphatase-1 regulator NIPP1 is also a splicing factor involved in a late step of spliceosome assembly PMID: 11909864 NIPP1 has a role in the nuclear targeting and/or retention of PP1 PMID: 15501817 Required for the global trimethylation of histone3 at lysine27 and is implicated in gene silencing by enhancer of zeste homolog (EZH)2. PMID: 17724462 NIPP1 is present in a complex with EED and EZH2 in vivo and has distinct binding sites for these proteins. PMID: 17804093 NMR structure of the NIPP1 FHA domain. PMID: 18253837 NIPP1 works as a molecular sensor for PP1 to recognize phosphorylated Sap155. PMID: 18842582

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.