Recombinant Human Non-Specific Lipid-Transfer Protein (SCP2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-04378P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Non-Specific Lipid-Transfer Protein (SCP2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-04378P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Non-Specific Lipid-Transfer Protein (SCP2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P22307 |
Target Symbol | SCP2 |
Synonyms | DKFZp686C12188; DKFZp686D11188; NLTP; NLTP_HUMAN; Non-specific lipid-transfer protein; Nonspecific lipid transfer protein; NSL TP; NSL-TP; OTTHUMP00000010488; OTTHUMP00000231766; OTTHUMP00000231767; OTTHUMP00000231768; OTTHUMP00000231769; OTTHUMP00000231770; OTTHUMP00000231772; OTTHUMP00000231773; OTTHUMP00000231774; OTTHUMP00000231776; OTTHUMP00000234662; Propanoyl CoA C acyltransferase; Propanoyl-CoA C-acyltransferase; SCP 2; SCP chi ; SCP X; SCP-2; SCP-chi; SCP-X; SCP2; SCPchi ; SCPX; Sterol carrier protein 2; Sterol carrier protein X |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL |
Expression Range | 1-143 |
Protein Length | Full Length of Isoform SCP2 |
Mol. Weight | 42.4kDa |
Research Area | Transport |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a crucial role in the peroxisomal oxidation of branched-chain fatty acids. Catalyzes the last step of the peroxisomal beta-oxidation of branched chain fatty acids and the side chain of the bile acid intermediates di- and trihydroxycoprostanic acids (DHCA and THCA). Also active with medium and long straight chain 3-oxoacyl-CoAs. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol and transfers phosphatidylcholine and 7-dehydrocholesterol between membrances, in vitro. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs.; Mediates the transfer of all common phospholipids, cholesterol and gangliosides from the endoplasmic reticulum to the plasma membrane. May play a role in regulating steroidogenesis. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol. Also binds fatty acids and fatty acyl Coenzyme A (CoA) such as phytanoyl-CoA. Involved in the regulation phospholipid synthesis in endoplasmic reticulum enhancing the incorporation of exogenous fatty acid into glycerides. Seems to stimulate the rate-limiting step in phosphatidic acid formation mediated by GPAT3. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs. |
Subcellular Location | [Isoform SCP2]: Peroxisome. Cytoplasm. Mitochondrion. Endoplasmic reticulum. Mitochondrion.; [Isoform SCPx]: Peroxisome. |
Protein Families | Thiolase family |
Database References | HGNC: 10606 OMIM: 184755 KEGG: hsa:6342 STRING: 9606.ENSP00000360569 UniGene: PMID: 28284963 |