Recombinant Human Non-Secretory Ribonuclease (RNASE2) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-07496P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Non-Secretory Ribonuclease (RNASE2) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-07496P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Non-Secretory Ribonuclease (RNASE2) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P10153 |
Target Symbol | RNASE2 |
Synonyms | (Eosinophil-derived neurotoxin)(RNase UpI-2)(Ribonuclease 2)(RNase 2)(Ribonuclease US) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
Expression Range | 28-161aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 44.4 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities. |
Subcellular Location | Lysosome. Cytoplasmic granule. Note=Matrix of eosinophil's large specific granule. |
Protein Families | Pancreatic ribonuclease family |
Database References | |
Tissue Specificity | Liver, lung, spleen, leukocytes and body fluids. |
Gene Functions References
- In healthy children, 95th Percentile values ranged from 1519 mg/kg at 0 months to 54.4 mg/kg at 144 months for fecal calprotectin (fCP) and from 9.9 mg/kg at 0 months to 0.2 mg/kg at 144 months for fecal eosinophil-derived neurotoxin (fEDN). There was a significant association between age and fCP concentrations and age and fEDN concentrations and a significant association between fEDN and fCP. PMID: 28169973
- EDN serum level could be considered a candidate molecule as a clinical biomarker for evaluating atopic dermatitis activity and a predictor of relapse PMID: 28866306
- Serum EDN level may be a useful marker for monitoring persistent airflow limitation in adult patients with asthma who had positive results for house-dust-specific IgE antibodies. PMID: 26534742
- increased in feces after the ingestion of enterocolitis-causative foods PMID: 24890227
- RNASE2 gene expression was differentially expressed in rheumatoid arthritis patients considering a sequence polymorphism. PMID: 25221852
- The antimicrobial protein, RNase 2 exhibits antiviral against respiratory syncytial virus. PMID: 9826755
- findings show substantial amounts of EPX/EDN localise in an extra-granular, low equilibrium density compartment of eosinophils PMID: 23053729
- A higher level of serum EDN was found specifically in patients with ALS, indicating that EDN may participate in the pathophysiology of Amyotrophic lateral sclerosis. PMID: 23533305
- Eosinophil protein X in urine from asymptomatic neonates is a biomarker significantly associated with later development of allergic sensitization, nasal eosinophilia, and eczema during the first 6 years of life PMID: 21680952
- atomic resolution structure PMID: 11876642
- crystal structure of a post-translationally modified form of eosinophil-derived neurotoxin (EDN) with four extra residues on its N terminus ((-4)EDN) has been solved and refined at atomic resolution (1 A) PMID: 11916383
- EDN and ECP are paralogs in human and Old World monkeys. PMID: 11959927
- evidence for glycosylphosphatidylinositol (GPI)-anchored neurotoxin on granulocytes PMID: 12606041
- data suggest that peripheral blood eosinophils from subjects with untreated asthma have increased inflammatory capacity, as reflected by greater intracellular concentrations of EDN PMID: 15356558
- Results reveal the dendritic cell-activating activity of eosinophil-derived neurotoxin and suggest that it is a likely participant of inflammatory and immune responses--an endogenous multifunctional immune alarmin. PMID: 15528350
- Results describe the crystal structure of placental ribonuclease inhibitor in complex with eosinophil-derived neurotoxin, and a mutational analysis based on this structure. PMID: 15755456
- May possibly be associated with the development of tropical pulmonary eosinophilia. PMID: 16014847
- Elevated glycosylated form of EDN in urine is associated with ovarian cancer PMID: 16428483
- EGO is a novel ncRNA gene expressed during eosinophil development and is necessary for normal MBP and EDN transcript expression. PMID: 17351112
- Data show that uEPX/c levels did not correlate with established markers of asthma severity and eosinophilic airway inflammation in atopic asthmatic children. PMID: 17641730
- MAZ and Sp1 play important roles on the transcriptional activation of the human edn promoter through specific binding to a 34-nt segment present in representative primate eosinophil rnase promoters. PMID: 17927842
- Urinary concentrations of eosinophil-derived neurotoxin in patients with atopic dermatitis show a significant positive correlation with disease severity. PMID: 17965582
- EDN can activate myeloid DCs by triggering the Toll-like receptor (TLR)2-myeloid differentiation factor 88 signaling pathway PMID: 18195069
- In three continental population groups (Asia, Europe, Africa), the angiogenin and RNase 2 genes appear to exhibit markedly less genetic heterogeneity with regard to T195C and A238G (ANG) and C425A (RNASE2) SNPs. PMID: 18636464
- No variation in genes encoding eosinophil-derived neurotoxin for Atopic dermatitis pathogenesis in this German cohort. PMID: 19014520
- the roles of the six discrete segments in transcription regulation were investigated and the -350/-329 region (ednR2) was shown to be involved in the regulation of edn expression PMID: 19115260
- ECP and EDN disrupt skin integrity and cause inflammation PMID: 19717523