Recombinant Human Non-Histone Chromosomal Protein Hmg-17 (HMGN2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03967P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Non-Histone Chromosomal Protein Hmg-17 (HMGN2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03967P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Non-Histone Chromosomal Protein Hmg-17 (HMGN2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P05204 |
Target Symbol | HMGN2 |
Synonyms | High mobility group (nonhistone chromosomal) protein 17 ; high mobility group nucleosomal binding domain 2; High mobility group nucleosome-binding domain-containing protein 2; High mobility group protein N2 ; HMG17; HMGN2; HMGN2_HUMAN; MGC5629; Non histone chromosomal protein HMG 17; Non-histone chromosomal protein HMG-17; Nonhistone chromosomal protein HMG 17; nonhistone chromosomal protein hmg-17 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK |
Expression Range | 1-90aa |
Protein Length | Full Length |
Mol. Weight | 36.4 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. |
Subcellular Location | Nucleus. Cytoplasm. Note=Cytoplasmic enrichment upon phosphorylation. |
Protein Families | HMGN family |
Database References | HGNC: 4986 OMIM: 163910 KEGG: hsa:3151 STRING: 9606.ENSP00000355228 UniGene: PMID: 28408162 |