Recombinant Human Non-Histone Chromosomal Protein Hmg-17 (HMGN2) Protein (GST)

Name: Recombinant Human Non-Histone Chromosomal Protein Hmg-17 (HMGN2) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03967P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Non-Histone Chromosomal Protein Hmg-17 (HMGN2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P05204
Target Symbol	HMGN2
Synonyms	High mobility group (nonhistone chromosomal) protein 17 ; high mobility group nucleosomal binding domain 2; High mobility group nucleosome-binding domain-containing protein 2; High mobility group protein N2 ; HMG17; HMGN2; HMGN2_HUMAN; MGC5629; Non histone chromosomal protein HMG 17; Non-histone chromosomal protein HMG-17; Nonhistone chromosomal protein HMG 17; nonhistone chromosomal protein hmg-17
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
Expression Range	1-90aa
Protein Length	Full Length
Mol. Weight	36.4 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation.
Subcellular Location	Nucleus. Cytoplasm. Note=Cytoplasmic enrichment upon phosphorylation.
Protein Families	HMGN family
Database References	HGNC: 4986 OMIM: 163910 KEGG: hsa:3151 STRING: 9606.ENSP00000355228 UniGene: PMID: 28408162 HMGN1 and HMGN2 remodel core and linker histone tail domains within chromatin. PMID: 28973435 Results provide evidence that HDAC6 could regulate HMGN2 acetylation levels and binding to Stat5a-responsive promoters, and therefore, Stat5a transcriptional activity in breast cancer cells. PMID: 27358110 elucidate a novel mechanism whereby the linker histone H1 prevents STAT5 binding at promoter DNA, and the PRL-induced dissociation of H1 mediated by HMGN2 is necessary to allow full STAT5 recruitment and promote the biological effects of PRL signaling PMID: 28035005 Data show that high mobility group nucleosomal binding domain 2 (HMGN2) knockdown induced the increased expression of alpha5beta1 integrin on cell membranes, which resulted in a significant increase in Klebsiella pneumoniae internalization. PMID: 27460641 Data show that chronic lymphocytic leukemia (CLL) cells present high-mobility group nucleosome-binding protein 2 (HMGN2) at membrane. PMID: 25156469 enhanced expression of HMGN2 in osteosarcoma cells by HMGN2 lentivirus, exerts inhibitory effects on growth and migration of osteosarcoma cells. PMID: 25530340 HMGN2 is an anti-tumor effector molecule of CD8 T cells. PMID: 25060707 A polypeptide, HMGN2, was isolated and may be an antimicrobial effector molecule of mononuclear leukocytes. PMID: 16204630 HMGN2 is modified by covalent attachment of small ubiquitin-related modifier 1 (SUMO1) by pro-inflammatory signal and identified the major SUMOylated lysine residues that localize to the HMGN2 nucleosome-binding domain at Lys-17 and Lys-35. PMID: 24872413 HMGN2 is a bona fide Aurora B substrate in vivo and show that its dynamic association to chromatin is controlled by Aurora B. PMID: 22267324 HMGN2 acts as a positive modulator of nuclear factor kappaB signalling to promote lipopolysaccharide-induced beta-defensin-2 expression. PMID: 21518253 HMGN2 protein has antimicrobial activity and is probably involved in innate immunity in vivo. PMID: 20842856 The association of the PRLr with HMGN2 enables Stat5a-responsive promoter binding, thus facilitating transcriptional activation and promoting anchorage-independent growth. PMID: 21816901 HMGN2 binds to both the acidic patch in the histone H2A-H2B dimer and to nucleosomal DNA near the entry/exit point, "stapling" the histone core and the DNA. PMID: 21730181 fragment of the HMGN2 protein homes to the nuclei of tumor cells and tumor endothelial cells and tumor endothelial cells in vivo PMID: 12032302 each of the 4 amino acids in the R-S-RL motif are the only residues absolutely essential for anchoring HMGN protein to nucleosomes, both in vivo and in vitro. PMID: 18299391

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.