Recombinant Human Nkg2-C Type Ii Integral Membrane Protein (KLRC2) Protein (His-SUMO)

Name: Recombinant Human Nkg2-C Type Ii Integral Membrane Protein (KLRC2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09779P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nkg2-C Type Ii Integral Membrane Protein (KLRC2) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P26717
Target Symbol	KLRC2
Synonyms	CD antigen CD159c; CD159 antigen like family member C; CD159 antigen-like family member C; CD159c; Killer cell lectin like receptor subfamily C, member 2; KLRC2; NK cell receptor C; NKG2-C type II integral membrane protein; NKG2-C-activating NK receptor; NKG2C activating NK receptor; NKG2C; NKG2C_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Expression Range	94-231aa
Protein Length	Extracellular Domain
Mol. Weight	31.8kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive natural killer (NK) cells and in maternal-fetal tolerance during pregnancy. Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection. Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.
Database References	HGNC: 6375 OMIM: 602891 KEGG: hsa:3822 STRING: 9606.ENSP00000371327 UniGene: PMID: 28987961 the data of this study extend the characterization of adaptive NK cell subsets that differentiate in response to human Cytomegalovirus, supporting a relationship between their distribution and NKG2C copy number PMID: 26994220 The new method offers the potential to use SNP arrays from genome wide association studies to study the frequency of KLRC2 deletion in other populations and its association with other diseases PMID: 27312142 Assessment of NK cell repertoires in 60 NKG2C(-/-) donors revealed a broad range of NK cell populations displaying characteristic footprints of adaptive NK cells, including a terminally differentiated phenotype, functional reprogramming, and epigenetic remodeling of the interferon (IFN)-gamma promoter. PMID: 27117418 HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire PMID: 26382247 genetic polymorphism is not associated with nasopharyngeal carcinoma in China PMID: 25636564 Data suggest the proinflammatory potential of NKG2C(bright) NK cells. PMID: 25667418 lack of expression of NKG2C may be associated with altered control of human cytomegalovirus infection in childhood PMID: 25150297 No difference in the prevalence of NKG2C deletion was observed. PMID: 24305414 NKG2C receptor deletion and a functional polymorphism in its ligand HLA-E may play a role in psoriasis susceptibility PMID: 24079744 NKG2C(hi)CD57+ NK cells respond specifically to acute infection with cytomegalovirus and not Epstein-Barr virus. PMID: 24740502 NKG2Cnull does not seem to constitute a risk factor for HPV-induced cervical lesions. PMID: 23911737 NKG2C zygosity influences CD94/NKG2C receptor function and the NK-cell compartment redistribution in response to human cytomegalovirus. PMID: 24030638 coexpression of killer cell Ig-like receptor (KIR) and NKG2C on expanded NK cell subsets could be related to a functional contribution of KIR in cytomegalovirus infection PMID: 23918974 NKG2Chi CD57hi natural killer cells are highly responsive to human cytomegalovirus-infected macrophages only in the presence of HCMV-specific antibodies, whereas they are functionally poor effectors of natural cytotoxicity. PMID: 23637420 The increased expression of NKG2C in HIV patients indicate that NKG2C is important in the defense against HIV infection and progression. PMID: 22074011 A significantly elevated proportion of ex vivo peripheral blood CD4 T cells, but not CD8 T cells or natural killer (NK) cells, from multiple sclerosis patients express NKG2C, which contributes to tissue injury. PMID: 23396942 HCMV-infected NKG2C(+/+) children displayed higher absolute numbers of NKG2A(+) and total NK cells than NKG2C(+/-) individuals. PMID: 22965785 expression by Vdelta2+ T cells is lower in pregnant women PMID: 19395088 CD94/NKG2C might be involved in triggering cytotoxic lymphocytes in patients with Toxic epidermal necrolysis and Stevens-Johnson syndrome PMID: 20132973 Common occurrence of NKG2-C gene deletion in the general population. PMID: 12618865 NKG2C is not essential for survival and reproduction, and is not associated with rheumatic diseases PMID: 14688071 strict gene regulatory mechanisms for CD94 and NKG2 gene expression on CD4+ cells PMID: 15550116 CD94/NKG2C may constitute an alternative T cell activation pathway capable of driving the expansion and triggering the effector functions of a cytotoxic T cell subset. PMID: 15940674

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.