Recombinant Human Nicotinamide N-Methyltransferase (NNMT) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-09261P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Nicotinamide N-Methyltransferase (NNMT) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-09261P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Nicotinamide N-Methyltransferase (NNMT) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P40261
Target Symbol NNMT
Synonyms EC 2.1.1.1; Nicotinamide N methyltransferase; Nicotinamide N-methyltransferase; NNMT; NNMT_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Expression Range 1-264aa
Protein Length Full Length
Mol. Weight 56.6kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Catalyzes the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway. Plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3. In a developmental context, contributes to low levels of the repressive histone marks that characterize pluripotent embryonic stem cell pre-implantation state. Acts as a metabolic regulator primarily on white adipose tissue energy expenditure as well as hepatic gluconeogenesis and cholesterol biosynthesis. In white adipocytes, regulates polyamine flux by consuming S-adenosyl-L-methionine which provides for propylamine group in polyamine biosynthesis, whereas by consuming nicotinamide controls NAD(+) levels through the salvage pathway. Via its product N1-methylnicotinamide regulates protein acetylation in hepatocytes, by repressing the ubiquitination and increasing the stability of SIRT1 deacetylase. Can also N-methylate other pyridines structurally related to nicotinamide and play a role in xenobiotic detoxification.
Subcellular Location Cytoplasm.
Protein Families Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Database References

HGNC: 7861

OMIM: 600008

KEGG: hsa:4837

STRING: 9606.ENSP00000299964

UniGene: PMID: 29974846

  • Our data indicate that NNMT is a promising biomarker that could be used to support the early and noninvasive diagnosis of Bladder cancer PMID: 29148015
  • Here we explored the association between NNMT gene polymorphisms and obesity. The subjects were recruited from male Chinese Han college student... the variation of the tagSNP, rs10891644, is significantly associated with obesity and the GT carriers are the susceptible population PMID: 29075643
  • our results suggest that the ZEB1/NNMT signaling axis induces phenotypic and metabolic plasticity, as well as mesenchymal gene expression in ovarian cancer cells upon chronic glucose deprivation PMID: 28412735
  • We demonstrate that NNMT outcompetes leucine carboxyl methyl transferase 1 (LCMT1) for methyl transfer from principal methyl donor SAM in biological systems. Inhibiting NNMT increased the availability of methyl groups for LCMT1 to methylate PP2A, resulting in the inhibition of oncogenic serine/threonine kinases (STK). PMID: 27810903
  • High expression level of NNMT is associated with pancreatic cancer. PMID: 26942567
  • This finding, for the first time, suggests the involvement of the NNMT gene rs694539 variant in the etiology of epilepsy. PMID: 26215836
  • this study provides the first demonstration that NNMT plays a role in the resistance to 5-fluorouracil in colorectal cancer cells PMID: 27323852
  • We suggest that lymph node metastatic adenoid cystic carcinoma (AdCC) cells acquire cancer stem cell features involving the up-regulation of NNMT and the loss of gap junction protein alpha-1, leading to epithelial-mesenchymal transition and consequent AdCC metastasis. PMID: 29277772
  • Progression of pulmonary hypertension is associated with the activation of the NNMT-1-methylnicotinamide pathway. PMID: 27581040
  • no SNP in NNMT is significantly associated with performance in 50-m run but rs2256292 is significantly associated with performance in 1000-m run in male Chinese college students PMID: 27900880
  • These findings indicate that the repression of NNMT may underlie nickel-induced H3K9 dimethylation by altering the cellular SAM/SAH ratio. PMID: 28420001
  • NNMT expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  • The results show that a SNP (rs1941404) in NNMT is significantly associated with hyperlipidemia, and the influence of rs1941404 variation on the resting energy expenditure may be the possible mechanism for rs1941404 variation to induce hyperlipidemia. PMID: 27999813
  • NNMT gene rs694539 variant is a genetic risk factor for migraine in women. PMID: 27726107
  • There were no associations between MTHFR C677T, NNMT rs694539 AG/AA polymorphisms and conotruncal heart disease. PMID: 25547204
  • Data show that nicotinamide N-methyltransferase (NNMT) and the metabolic state regulate pluripotency in embryonic stem cells (hESCs). PMID: 26571212
  • results further reinforce a central role for NNMT in the regulation of energy homeostasis and provide further mechanistic insight into the consequences of enhanced NNMT expression PMID: 26456643
  • White adipose tissue NNMT expression is regulated in human insulin resistance and type 2 diabetes and that plasma MNA correlates with increased tissue NNMT expression and the degree of insulin resistance. PMID: 25596852
  • The downregulation of NNMT significantly reduced in vitro tumorigenicity of A549 cells. PMID: 25204218
  • increasing Nnmt expression or MNAM levels stabilizes sirtuin 1 protein, an effect that is required for their metabolic benefits PMID: 26168293
  • Data sugguest that NNMT plays an important role in PANC-1 cell proliferation, metastatic potential and survival under metabolic stress. PMID: 25592232
  • results suggest that the NNMT SNP rs694539 may have a role in the etiology of schizophrenia in a Han Chinese female population PMID: 25317069
  • NNMT is associated with microRNA-1291-altered pancreatic carcinoma cell metabolome and suppressed tumorigenesis. PMID: 25115443
  • NNMT enhances the capacity of tumorigenesis associated with the inhibition of cell apoptosis and the promotion of cell cycle progression in human colorectal cancer cells PMID: 25201588
  • Down-regulation of NNMT induces apoptosis via the mitochondria-mediated pathway in breast cancer cells. PMID: 24558488
  • The rs694539 variant of NNMT gene is a genetic risk factor for developing nonalcoholic steatohepatitis. PMID: 23964925
  • NNMT expression regulates neurone morphology in vitro via the sequential activation of the EFNB2 and Akt cellular signalling pathways. PMID: 23764850
  • Data indicate that nicotinamide N-methyltransferase (NNMT) positively correlated with protein kinase B (pAkt) expression and was independent adverse prognosticators of patient survival. PMID: 23838801
  • Genetic association of the rs694539 variant of nicotinamide-N-methyltransferase gene with bipolar disorder. PMID: 24004542
  • The nicotinamide N-methyltransferase expression levels were significantly higher in patients with bladder tumor compared to controls that showed very low or undetectable amounts of NNMT transcript and protein. PMID: 23097023
  • High serum NNMT is associated with kidney cancer. PMID: 23479363
  • using metabolomics, observation that NNMT impairs the methylation potential of cancer cells by consuming methyl units from S-adenosyl methionine to create the stable metabolic product 1-methylnicotinamide PMID: 23455543
  • This study suggested that NNMT is involved in the aetiology of schizophrenia PMID: 21791160
  • a marked increase in enzyme activity in oral cancer PMID: 22628313
  • Structural basis of substrate recognition in human nicotinamide N-methyltransferase PMID: 21823666
  • NNMT has a crucial role in cellular invasion via activating PI3K/Akt/SP1/MMP-2 pathway in clear cell renal cell carcinoma (ccRCC). PMID: 21045016
  • NNMT is over-expressed in a large proportion in renal cell cancers. High NNMT expression is significantly associated with unfavorable prognosis. PMID: 20104648
  • the present study suggests that NNMT may have potential as a biomarker and as a therapeutic target for OSCCoral squamous cell carcinoma PMID: 19924637
  • A potential role in predicting response to radiation in bladder cancer PMID: 12216074
  • HNF-1beta functions as a transcription activator for NNMT gene expression in some papillary thyroid cancer cells PMID: 15486044
  • A genomewide exploration suggested NNMT as a new candidate and major determinant of plasma homocystein levels. PMID: 15849667
  • NNMT serum levels may have significance in the early detection and in the management of patients with colorectal cancer. PMID: 16166432
  • depsipeptide represses NNMT and HNF-1beta gene expression in some papillary thyroid cancer cells PMID: 16676400
  • NNMT genotype is not a strong determinant of the tHcy concentration but it may have a modifying effect on plasma homocysteine concentration in Japanese men PMID: 17434578
  • NNMT is a novel Stat3-regulated gene and may be a potential candidate for a tumor marker of various kinds of cancers PMID: 17922140
  • No association was found between infant nicotinamide N-methyl transferase gene variants and risk for spina bifida in our study population. PMID: 18553462
  • Adipose tissue ss a source of nicotinamide N-methyltransferase and homocysteine PMID: 18996527
  • For the first time, we associate the RFC1 80G>A and NNMT IVS -151C>T variants to an increased acute lymphoblastic leukemia susceptibility. PMID: 19020309
  • NNMT gene expression is associated with tumor stage and DFS time in hepatocellular carcinoma cases. PMID: 19216803
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed