Recombinant Human Nicotinamide Mononucleotide Adenylyltransferase 3 (NMNAT3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10193P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Nicotinamide Mononucleotide Adenylyltransferase 3 (NMNAT3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10193P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Nicotinamide Mononucleotide Adenylyltransferase 3 (NMNAT3) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q96T66 |
| Target Symbol | NMNAT3 |
| Synonyms | NaMN adenylyltransferase 3; Nicotinamide mononucleotide adenylyltransferase 3; Nicotinamide nucleotide adenylyltransferase 3; Nicotinate-nucleotide adenylyltransferase 3; NMN adenylyltransferase 3; NMNA3_HUMAN; NMNAT 3; Nmnat3; PNAT 3; PNAT-3; PNAT3; Pyridine nucleotide adenylyltransferase 3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS |
| Expression Range | 1-215aa |
| Protein Length | Full Length of Isoform 2 |
| Mol. Weight | 40.1kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Can also use GTP and ITP as nucleotide donors. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, can use NAD(+), NADH, NaAD, nicotinic acid adenine dinucleotide phosphate (NHD), nicotinamide guanine dinucleotide (NGD) as substrates. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NaADP(+). Protects against axonal degeneration following injury. |
| Subcellular Location | Mitochondrion. |
| Protein Families | Eukaryotic NMN adenylyltransferase family |
| Database References | HGNC: 20989 OMIM: 608702 KEGG: hsa:349565 STRING: 9606.ENSP00000340523 UniGene: PMID: 24155910 |
