Recombinant Human Neutrophil Defensin 3 (DEFA3) Protein (His-SUMO)

Name: Recombinant Human Neutrophil Defensin 3 (DEFA3) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09211P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Neutrophil Defensin 3 (DEFA3) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P59666
Target Symbol	DEFA3
Synonyms	DEFA3; DEF3Neutrophil defensin 3; Defensin; alpha 3; HNP-3; HP-3; HP3) [Cleaved into: HP 3-56; Neutrophil defensin 2; HNP-2; HP-2; HP2)]
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Expression Range	39-94aa
Protein Length	Partial
Mol. Weight	22.4 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Subcellular Location	Secreted.
Protein Families	Alpha-defensin family
Database References	HGNC: 2762 OMIM: 604522 KEGG: hsa:1668 STRING: 9606.ENSP00000328359 UniGene: Hs.654448

Gene Functions References

High HNP3 expression is associated with IgA Nephropathy. PMID: 27563166
Elevated DEFA3 levels in diabetes are independent of DEFA3 copy numbers. PMID: 25083086
DEFA3 encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa. PMID: 2997278
alpha-Defensin (DEFA3)was the third most differentially overexpressed gene and may be related to the onset of Bell's palsy and Ramsay Hunt Syndrome. PMID: 22737966
The total amount of gingival crevicular fluid human neutrophil peptide 3 were not different among periodontitis, gingivitis, and health control groups; there was no correlation with clinical periodontal parameters. PMID: 20151808
BPI and HNP 1-3 are accumulated in the synovial cavity of patients with rheumatoid arthritis PMID: 12913926
Aerobic bacteria were 100% susceptible to HBD-2 and HBD-3, whereas only 21.4 and 50% of the anaerobes were susceptible to HBD-2 and HBD-3. PMID: 15004048
HNP-3 is a potentially important regulator of neovascularizaiton, suggesting a new link between inflammation and angiogenesis. PMID: 15208269
We have tested the DEFA3 absence in 697 samples from different human populations. The proportion of subjects lacking DEFA3 varies from 10% to 37%, depending on the population tested, suggesting differences in innate immune function between populations. PMID: 17214878
Clostridium difficile toxin B interacts with high affinity with HNP-3 which may provide a defense mechanism against clostridial glucosylating cytotoxins. PMID: 18435932
Upregulation of HNP3 is associated with colorectal adenomas and carcinomas. PMID: 18957723
Salivary HNP-3concentrations increased following exercise PMID: 19263072
DEFA3 was upregulated in IPF patients with acute exacerbation PMID: 19363140
Studies indicate alpha-defensin, the products of neutrophils wase upregulated at the mRNA and protein levels in SLE patients. PMID: 19758174
Plasma levels of alpha-defensins 1-3 are an indicator of neutrophil activation in pregnant and post-partum women. PMID: 17845323

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.