Recombinant Human Neurotrophin-4 (NTF4) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08333P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Neurotrophin-4 (NTF4) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08333P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Neurotrophin-4 (NTF4) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P34130
Target Symbol NTF4
Synonyms GLC10; GLC1O; Neurotrophic factor 4; Neurotrophic factor 5; Neurotrophin 4; Neurotrophin 4/5; Neurotrophin 5 (neurotrophin 4/5); Neurotrophin 5; Neurotrophin-4; Neurotrophin-5; Neutrophic factor 4; Neutrophic factor 5; NT 4; NT 4/5; NT 5; NT-4; NT-5; NT4; NT4/5; NT4P; NT5; NTF4; NTF4_HUMAN; NTF5
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Expression Range 82-210aa
Protein Length partial
Mol. Weight 17.9kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function derived survival factor for peripheral sensory sympathetic neurons.
Subcellular Location Secreted.
Protein Families NGF-beta family
Database References

HGNC: 8024

OMIM: 162662

KEGG: hsa:4909

STRING: 9606.ENSP00000301411

UniGene: PMID: 24607879

  • The NTF4 variants p.Gly157Ala and p.Ala182Val have been shown to be functional mutations, occurring in 2 of a total of 720 Chinese primary open-angle glaucoma patients. PMID: 22815630
  • NT-4/5 expression is associated with atrophy of the brain-parenchymal fraction measured by magnetic resonance imaging methods in patients with relapsing-remitting multiple sclerosis. PMID: 22036954
  • Suggest that a dysregulated TrkB/NT4/5 axis may contribute to several of the pathological lesions associated with pulmonary fibrosis, including type 2 alveolar cell hyperplasia and the proliferation of fibroblasts. PMID: 21330466
  • neurotrophin 4 contributes to breast cancer cell survival and can serve as prospective target to inhibit tumor growth PMID: 21350004
  • In vitro follicular assembly is significantly increased in fetal ovaries cultured with NT-4. PMID: 20447632
  • Identification of a single mutation in our study suggests that NTF4 mutations are a rare cause of primary open-angle glaucoma (0.6%, 95%CI 0.02%-3.16%) in Chinese people. PMID: 20806036
  • present data indicate a lack of involvement of variations in NTF4, VAV2, and VAV3 with glaucoma pathogenesis in an Indian population. PMID: 20463313
  • Expression of human NTF4 was unchanged during gestation in the developping ovary. PMID: 20175187
  • No evidence of association of heterozygous NTF4 mutations in patients with primary open-angle glaucoma. PMID: 20215012
  • A mechanism to understand the defect associated with variant BDNF and provide a framework two ligands for BDNF and NT-4. PMID: 15987945
  • Re-expression of the p75NTR appears to partially reverse de-differentiation of prostate cancer cells by up-regulating the expression of CRABPI for localized sequestration of retinoids. PMID: 16316409
  • Results revealed the expression of NT-4/5 mainly in oocytes and, in a minority of samples, also in the granulosa cells (GCs). PMID: 16648150
  • These novel data demonstrate that neurotrophins influence ASM [Ca(2+)](i) and force regulation and suggest a potential role for neurotrophins in airway diseases PMID: 16648236
  • Neurotrophin 4/5 plays a role in the proliferation and differentiation of periodontal ligament cells. PMID: 18980528
  • Data show that the levels of NT-4/5 levels are significantly higher in bipolar disorder patients than in controlsNT-4/5. immunocontent alterations in bipolar disorder. PMID: 19081579
  • NTF4 mutations impair neurotrophin-4 signaling in patients with primary open-angle glaucoma and lead to decreased activation of TrkB PMID: 19765683
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed