Recombinant Human Neurotensin/Neuromedin N (NTS) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04264P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Neurotensin/Neuromedin N (NTS) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04264P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Neurotensin/Neuromedin N (NTS) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P30990
Target Symbol NTS
Synonyms Human proneurotensin; Large neuromedin N; Neuromedin N preproprotein; Neurotensin/neuromedin N; NEUT_HUMAN; NMN 125; NmN; NmN-125; NN; NT; NT/N; NTRH; NTS; NTS1; Pro neurotensin/neuromedin; Proneuromedin N mRNA; Tail peptide
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK
Expression Range 24-143aa
Protein Length Partial
Mol. Weight 29.7kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Subcellular Location Secreted. Cytoplasmic vesicle, secretory vesicle. Note=Packaged within secretory vesicles.
Protein Families Neurotensin family
Database References

HGNC: 8038

OMIM: 162650

KEGG: hsa:4922

STRING: 9606.ENSP00000256010

UniGene: PMID: 29546332

  • Neurotensin plasma values differentiate healthy people from patients suffering from colonic pathologies such as adenomatous polyps and adenocarcinoma. PMID: 28560510
  • NTS may be an important stimulus to promote hepatocellular carcinoma invasion and metastasis both in vitro and in vivo. PMID: 27611941
  • Higher concentrations of proneurotensin are associated with a greater risk of incident cardiovascular events in the community. This association did not vary according to sex, baseline low-density lipoprotein, or sortilin receptor 1 genotype. PMID: 27312221
  • sortilin is a PIP3 binding protein with binding likely to occur at the C-terminal neurotensin binding site, and is a competitor of neurotensin PMID: 27666481
  • children with untreated coeliac disease have elevated peripheral pro-NT levels compared with disease controls. Pro-NT levels also seem to reflect more severe forms of active coeliac disease, indicating a potential role of NT in small intestinal inflammation. PMID: 27612962
  • findings directly link NT with increased fat absorption and obesity and suggest that NT may provide a prognostic marker of future obesity and a potential target for prevention and treatment PMID: 27193687
  • Although no measures for pain threshold, thermal instability or gastric motility were performed in our study participants, higher plasma NT levels were found in PWS children PMID: 25847417
  • pretreatment of gastric cancer cells with NTR1 inhibitor SR48692 was shown to significantly inhibit the NT-mediated MMP-9 activity, cell invasion, and migration PMID: 25724188
  • NTS/IL-8/CXCR1/STAT3 signaling is crucial for the maintenance of stem-like traits in glioblastoma stem cells . PMID: 25200966
  • NTS/NTSR1 complex enhances breast tumor aggressiveness via EGFR/HER2/HER3 pathway. PMID: 25249538
  • Neurotensin and its receptor NTSR1 causes EGFR, HER2 and HER3 over-expression and their autocrine/paracrine activation in lung adenocarcinomas, confirming responsiveness to erlotinib. PMID: 25249545
  • indicate that neurotensin is a direct target of the Wnt/beta-catenin pathway and may be a mediator for neuroendocrine tumor cell growth PMID: 25098665
  • The antimicrobial peptide neurotensin has activity against invasive microbes. PMID: 12074933
  • Results show that both the neurotensin (NT) and the neurotensin 1 receptor hNTS1(321-344)fragment present a 3D structure in complex. PMID: 23140271
  • NT production by keratinocytes may exert a paracrine effect on other skin cells, namely fibroblasts, macrophages, and dendritic cells for correct wound healing. PMID: 24198343
  • These findings provide new insights into the potential therapeutic role of NT in chronic wounds, such as in DFU, characterized by a deficit in the migratory properties of cells and a chronic proinflammatory status. PMID: 24000330
  • Neurotensin-mediated calcium signaling appears more sensitive to differentiation than ATP-mediated Ca(2+) signaling PMID: 23962427
  • Nanoparticles exposing neurotensin tumor-specific drivers. PMID: 23436714
  • Data indicate synchronous increase of neurotensin (NTS) and IL-8 in hepatocellular carcinoma (HCC) correlated with worse prognosis and shorten survival after surgery. PMID: 23418512
  • Proneurotensin expression in the tumor tissues indicated that this precursor was produced by small cell lung carcinoma tumors and secreted into plasma as the tumors grew. PMID: 22825476
  • a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin PMID: 23064014
  • NTSR2 was overexpressed, NTSR1 decreased, and neurotensin was not expressed in B cell leukemia patient's B-cells, as compared with healthy B cells. PMID: 23109725
  • Neurotensin secretion is regulated by PI3 kinase p110 alpha and protein kinase B signaling pathways. PMID: 22700584
  • Endothelin-converting enzyme-1 (ECE-1) degrades NT in acidic conditions, and its activity is crucial for NTR1 recycling. PMID: 22416137
  • CD133(+) liver tumor-initiating cells promote tumor angiogenesis, growth, and self-renewal through neurotensin/interleukin-8/CXCL1 signaling. PMID: 21994122
  • Neurotensin signaling activates microRNAs-21 and -155 and Akt, promotes tumor growth in mice, and is increased in human colon tumors. PMID: 21806946
  • Neurotensin signaling induces intracellular alkalinization and interleukin-8 expression in human pancreatic cancer cells. PMID: 19393580
  • determined the status of ERalpha and ERbeta in the myometrium and leiomyomas, atypical leiomyomas and leiomyosarcomas, concomitantly with the expression of NTS/NTS receptor 1 in these tumors PMID: 21623207
  • Human, pig, and frog NT and [Gln(4)]NT and [D-Tyr(11)]NT adsorbed to the silver surface via the tyrosine ring, the oxygen atom of the deprotonated phenol group of Tyr(11), and the -CH(2)- unit(s), most probably of Tyr(11), Arg(9), and/or Leu(13). PMID: 21542591
  • study found that inhibition of mTORC1 signaling by rapamycin, torin1, and shRNA-mediated knockdown enhances NT secretion by increasing NT gene expression in the endocrine cell line BON PMID: 21508335
  • Expression of neurotensin and ghrelin systems are markedly altered in the temporal lobe of Alzheimer's disease patients, which may contribute to the severe cognitive deficit observed in this pathology. PMID: 20858966
  • Results indicate that the counteraction of neurotensin and neurotensin receptor subtype-1 regulates the genesis and development of pancreatic carcinomas. PMID: 21272935
  • NT acutely regulates D2 autoreceptor function and DA neuron excitability through PKC-mediated phosphorylation of the D2R, leading to heterologous receptor desensitization. PMID: 21233215
  • IGF-1R activation represents a previously unrecognized key pathway involved in the mechanisms by which NT and NTR1 modulate colonic inflammation and inflammatory bowel disease. PMID: 21212273
  • Data show that neurotensin- and NTSR1-positive mmunohistochemistry staining in 60.4% and 59.7% of lung adenocarcinomas, respectively. PMID: 20810387
  • key regulatory elements in the promoter region that are involved in human NT/N (hNT/N) gene expression PMID: 21030593
  • Neurotensin is increased in serum of young children with autistic disorder. PMID: 20731814
  • The expression of NTS is identified as a prognostic marker in patients with malignant pleural mesothelioma. PMID: 19932148
  • neurotensin /NTR1 signaling in pancreatic cancer cells seems to promote the induction of a metastatic phenotype, in contrast to its varying effects on tumor cell proliferation. PMID: 20138826
  • The aim of this study was to provide an up-to-date review of the literature concerning the regulatory role of NT on the hypothalamic-anterior pituitary axons--REVIEW PMID: 19878995
  • topography of its binding site to NT 1 receptor PMID: 11906607
  • Neurotensin induces protein kinase C-dependent protein kinase D activation and DNA synthesis in human pancreatic carcinoma cell line PANC-1. PMID: 11912133
  • role in counteracting apoptosis in breast cancer cells PMID: 12150975
  • Neurotensin expressing neurons develop earlier than vasoactive intestinal polypeptide, vasopressin, and neuropeptide Y expressing neurons in the suprachiasmatic nucleus. (neurotensin) PMID: 12531461
  • neurotensin has a role in chronic mitogen-activated protein kinase activation and cancer progression PMID: 14699144
  • Analysis of the NTS genomic sequence revealed 2 intronic polymorphisms and 1 variant located in the 5' untranslated region (UTR). None of the observed variants co-segregated with RLS and no disease-associated polymorphisms were detected PMID: 14743366
  • neurotensin secretion is mediated by protein kinase C-alpha/-delta and Rho/Rho kinase, and protein kinase D PMID: 15123666
  • Transcription of NT in the mitochrondria of BON cells in response to pharmacologic manipulation. PMID: 15358593
  • MARCKS-mediated neurotensin release occurs via protein kinase C-delta downstream of the Rho/ROK pathway PMID: 15623535

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed