Recombinant Human Neuroserpin Protein (SERPINI1), Active
Beta LifeScience
SKU/CAT #: BLC-05557P
Recombinant Human Neuroserpin Protein (SERPINI1), Active
Beta LifeScience
SKU/CAT #: BLC-05557P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Neuroserpin Protein (SERPINI1), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE and HPLC. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2000 IU/mg. |
| Uniprotkb | Q99574 |
| Target Symbol | SERPINI1 |
| Synonyms | DKFZp781N13156; Neuroserpin; NEUS_HUMAN; Peptidase inhibitor 12; PI-12; PI12; Protease inhibitor 12 ; Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1; Serine or cysteine proteinase inhibitor clade I member 1; Serpin I1; Serpin peptidase inhibitor clade I (neuroserpin) member 1; SERPINI1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL |
| Expression Range | 17-410aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 44.7 kDa |
| Research Area | Neuroscience |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 µm filtered PBS, pH 7.5 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable). |
| Subcellular Location | Secreted. Cytoplasmic vesicle, secretory vesicle lumen. Perikaryon. |
| Protein Families | Serpin family |
| Database References | HGNC: 8943 OMIM: 602445 KEGG: hsa:5274 STRING: 9606.ENSP00000295777 UniGene: PMID: 28631894 |
