Recombinant Human Neuropeptide Y Receptor Type 2 (NPY2R) Protein (His-SUMO)

Name: Recombinant Human Neuropeptide Y Receptor Type 2 (NPY2R) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-00434P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Neuropeptide Y Receptor Type 2 (NPY2R) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P49146
Target Symbol	NPY2R
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV
Expression Range	326-381aa
Protein Length	Partial
Mol. Weight	19.3 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 7957 OMIM: 162642 KEGG: hsa:4887 STRING: 9606.ENSP00000332591 UniGene: PMID: 27584037 not detected in infantile hemanogiomas PMID: 27889920 polymorphisms in the NPY2R gene may be useful in identifying women at risk for osteoporosis. PMID: 25871004 Data show that the Y2-receptor high expression G allele is associated with a less efficient mode of action cascading where different task goals are activated in parallel. PMID: 25157429 The molecular mobility of the human neuropeptide Y receptor type 2 reconstituted into dimyristoylphosphatidylcholine (DMPC) membranes was investigated by means of solid-state NMR spectroscopy. PMID: 24623336 The results of this study provide evidence that the functionally relevant single nucleotide polymorphism (SNP) in the NPY2R promoter gene affect circumscribed processes of early sensory processing PMID: 24709141 This study reviews neuropeptide Y2 receptor modulators (mainly non-peptidic antagonists) and their structure-activity relationships. PMID: 24365162 this study concludes that common genetic variation in the proximal NPY2R promoter influences transcription factor binding so as to alter gene expression in neuroendocrine cells, and consequently cardiometabolic traits in humans. PMID: 23149563 we determined the role of the C-terminus in the anterograde transport of the human neuropeptide Y receptor (hYR) type 2 PMID: 23020974 Surface masking of the Y2 receptor could to a degree reflect restricted access of the large (34-36-residue) physiological agonists. PMID: 22732667 NPY2R expression in neonatal saliva is predictive of an immature feeding pattern. PMID: 22629465 Four genetic loci were strongly and independently associated with obesity, NPY2R, NPFFR2, MC4R, and FTO. PMID: 21818152 protocol for the preparation of fully active Y2 G protein-coupled receptor PMID: 21999704 Data present a site-directed mutagenesis study of four amino acid positions in the human Y2 receptor. PMID: 21696823 Results report on the functional reconstitution of the hY(2)R and the hY(4)R in Sf9 insect cells using the baculovirus system. PMID: 21745157 Increased expression of NPY-Y2 receptors in symptomatic carotid plaque vascular smooth muscle cells. PMID: 21352822 These results suggest that the rs4425326 polymorphism in NPY2R may be a possible genetic factor for nicotine dependence in the Japanese elderly population. PMID: 20811389 Ligand-induced internalization and recycling of the human neuropeptide Y2 receptor is regulated by its carboxyl-terminal tail PMID: 20959467 effect on metabolic parameters of single nucleotide polymorphisms in the 5'-flanking region of NPY2R gene PMID: 20359722 NPY receptor Y2 polymorphism is independently associated with left ventricular mass index and interacts with plasma levels of NPY in explaining the variability of left ventricular hypertrophy in ESRD. PMID: 20543711 Described is the membrane reconstitution of the refolded human neuropeptide Y receptor Type 2 (Y2 receptor) into phospholipid membranes. PMID: 20421142 Several LEP, and NPY2R and PYY SNPs were associated with obesity-related phenotypes in young adults, particularly among African-Americans. PMID: 20642810 Mutation rate of the rs1047214 polymorphism in NPY2R gene in Chinese adolescents was higher than in foreign populations. Polymorphism seemed to be associated with obesity in males but did not in phenotypes of metabolic syndrome. PMID: 19957593 Report binding and pharmacology of neuropeptide Y Y2 receptor antagonist JNJ-31020028. PMID: 19953226 Peptide YY and neuropeptide Y exert their effects through the NPY2 receptors, which are located on intrinsic neurons as well as epithelia in colon mucosa. PMID: 11906964 tonic activation of submucosal Y(2) receptors could indirectly reduce mucosal ion transport in the colon, while direct activation of Y(2) receptors on longitudinal muscle results in contraction PMID: 12813010 mutations in PYY and Y2R are not commonly found in humans with severe early-onset obesity. PMID: 15331560 High expression of neuropeptide Y receptor Y2 is associated with tumors of the human adrenal gland and extra-adrenal paraganglia PMID: 15623622 Y2R pathway may influence body weight through a sex-specific mechanism. PMID: 15855352 Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY2R). PMID: 16891622 Common variants in the 5' region of NPY2R are associated with obesity in Danish white subjects. PMID: 17019604 A rare variant of the NPY2R gene showed evidence of co-segregation with obesity. PMID: 17235527 NPY2R should be considered a candidate gene for type 2 diabetes in men. PMID: 17325259 In case-control analyses and a family-based association study an association with obesity for seven common variants was not detected; additional gender-stratified analyses were also nonsignificant. PMID: 17992642 The rabbit kidney and the human CHO cell-expressed Y2 dimers are converted by agonists to monomers in vitro at a similar rate in the presence of divalent cations. PMID: 18569526 Y2R gene variants are involved in blood pressure regulation in obese children and adolescents PMID: 18622237 the N-terminal extracellular segment of the neuropeptide Y Y2 receptor thus apparently has a large role in anchoring and compartmentalization of the receptor PMID: 18700141 Single nucleotide polymorphisms in NPY2R provide significant evidence of association with alcohol dependence, alcohol withdrawal symptoms, comorbid alcohol and cocaine dependence, and cocaine dependence. PMID: 18828811

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.