Recombinant Human Neuronal Acetylcholine Receptor Subunit Beta-2 (CHRNB2) Protein (His-V5)

Name: Recombinant Human Neuronal Acetylcholine Receptor Subunit Beta-2 (CHRNB2) Protein (His-V5)
Brand: Beta LifeScience
SKU: BLC-01619P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Neuronal Acetylcholine Receptor Subunit Beta-2 (CHRNB2) Protein (His-V5) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P17787
Target Symbol	CHRNB2
Synonyms	CHRNB2; Neuronal acetylcholine receptor subunit beta-2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-V5
Target Protein Sequence	TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK
Expression Range	26-233aa
Protein Length	Partial
Mol. Weight	31.9 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions.
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Database References	HGNC: 1962 OMIM: 118507 KEGG: hsa:1141 STRING: 9606.ENSP00000357461 UniGene: PMID: 26904947 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure. PMID: 25068303 The results of this study suggested that rs2072660 had a significant effect on the nicotine dependence There was no direct association between depressive phenotype (with neither ZSDS total scores and nor its subscales) and CHRNB2 variants. PMID: 25640319 Following smoking reduction and cessation alpha4beta2* nAChR densities were decreased across brain regions. PMID: 23429692 Evidence for significant association between common sequence variants in CHRNB2 and nausea severity was obtained after adjusting for age, gender and correlated tests in patients using varenicline for smoking cessation. PMID: 21606948 A novel mutant mouse harboring the human ADNFLE mutation in the Chrnb2 gene was generated and used to study the roles of beta2* nicotinic receptors in complex biological processes including the activity-rest cycle, natural reward and anxiety. PMID: 20603624 variation in the promoter region of CHRNB2 gene may be important in mediating levels of expression of the beta2 nicotinic receptor subunit, which may be associated with variation in subjective response to nicotine PMID: 20854418 mutations of CHRNB2 and CHRNA2 genes may be rare in Chinese autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE) PMID: 21287502 Concatameric pentamers and pentamers formed from combinations of trimers, dimers, and monomers of alpha6beta2beta3* acetylcholine receptors exhibit similar properties, indicating that the linkers between subunits do not alter their functional properties. PMID: 20923852 The high sensitivity to activation and desensitization of (alpha4beta2)alpha5 nAChRbeta2 by nicotine results in a narrow concentration range in which activation and desensitization curves overlap. PMID: 20881005 Using high-resolution NMR spectroscopy, we solved the structure of the entire transmembrane domain (TM1234) of the beta2 subunit. We found that TM1234 formed a four-helix bundle in the absence of the extracellular and intracellular domains. PMID: 20441771 Data suggests that beta(2)-nAChRs play a role in pain sensitivity but not pain tolerance during tobacco smoking withdrawal. PMID: 20371741 There was no evidence of association of any of the SNPs in CHRNAB2 (rs2072661, rs4845378) or CHRNAB3 (rs4953, rs6474413) with smoking status (p=0.30) or, among daily smokers, of association with cotinine levels (p=0.08). PMID: 19482438 association of a 3' untranslated region polymorphism (rs2072661) in the nicotinic acetylcholine receptor beta2 subunit (CHRNB2) gene with quitting success in response to nicotine versus placebo patch during a short-term test of patch effects. PMID: 19755656 CHRNB2 is a logical candidate for influencing smoking behavior and nicotine dependence PMID: 11906688 autosomal dominant nocturnal frontal lobe epilepsy probands were analyzed for the presence of V287L and V287M mutations in the CHRNB2 gene. No mutations in the analyzed region of CHRNB2 found. PMID: 11952766 Mutations of the gene encoding CHRNB2 may be linked to nocturnal frontal lobe epilepsy. PMID: 12185808 CHRNB2 subunit is expressed in the soma of the majority of pyramidal cells, with the most beta 2 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma. PMID: 12663058 Mutations in genes coding for the alpha 4 and beta 2 subunits of the neuronal nicotinic acetylcholine receptor receptor (CHRN) are known to cause autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE). PMID: 12681012 A significant association for Alzheimer's disease is observed for a non-coding polymorphism in CHRNB2 subunit. PMID: 15026168 Nicotinic acetylcholine receptor beta 2 subunit polymorphisms are not a useful marker for prediction of the susceptibility.to febrile seizures. PMID: 15033200 Here, we report a new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. PMID: 15964197 Greater beta2-nAChR availability during early abstinence may impact the ability of smokers to maintain abstinence. PMID: 16928859 This study provides the first evidence for association between the CHRNB2 gene and nicotine- and alcohol-related phenotypes, and suggests that polymorphisms in CHRNB2 may be important in mediating early responses to nicotine and alcohol. PMID: 17226798 To our knowledge, this is the third family reported presenting a mutation in CHRNB2 in nocturnal frontal lobe epilepsy. PMID: 17900292 These results in living human subjects corroborate postmortem reports of decline in high affinity nicotine binding with age and may aid in elucidating the role of beta(2)-nAChRs in cognitive aging. PMID: 18242781 Genetic testing revealed the CHRNB2 mutation I312M in transmembrane region 3 (M3) of the neuronal nicotinic acetylcholine receptor. PMID: 18534914 An SNP (rs2072661) in the 3' UTR region of the CHRNB2 has an impact on abstinence rates at the end of treatment and after a 6-month follow-up period. PMID: 18593715

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.