Recombinant Human Neuronal Acetylcholine Receptor Subunit Alpha-7 (CHRNA7) Protein (His)

Name: Recombinant Human Neuronal Acetylcholine Receptor Subunit Alpha-7 (CHRNA7) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07607P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Neuronal Acetylcholine Receptor Subunit Alpha-7 (CHRNA7) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P36544
Target Symbol	CHRNA7
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT
Expression Range	23-230aa
Protein Length	Partial
Mol. Weight	30.4 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin.
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-7/CHRNA7 sub-subfamily
Database References	HGNC: 1960 OMIM: 118511 KEGG: hsa:1139 UniGene: PMID: 27789755 alpha7 nAChR may play an important role in neuropathology caused by gp120. PMID: 28074940 These findings demonstrate that a7nAChR plays an important role in H1299 cell proliferation, tumor growth and expression of vimentin. Therefore, blocking a7nAChRs in non-small cell lung cancer (NSCLC) may be a potential adjuvant therapy for the targeted treatment of NSCLC PMID: 29039603 Results revealed that alpha7nAChR expressed in tumor-associated macrophages may play an important role in preventing metastasis through the JAK2/STAT3 signaling pathway and could be a prognosis marker in colorectal cancer. PMID: 28901507 Study found no significant association was between CHRNA7 and vascular dementia. PMID: 27249957 CHRNA7 regulates osteoclast differentiation during physiological root resorption. PMID: 28494644 This study found the rs6494223 TC genotype within CHRNA7 increasing the risk for Bipolar Disorder. PMID: 28494468 these results indicate that nicotine induces non-small cell lung cancer cell invasion, migration, and epithelial to mesenchymal transition ; the effects are mediated by alpha7-nAChRs and involve MEK/ERK signaling pathway PMID: 27409670 This study describes screening methodology for identifying bioactive compounds in mixtures acting on the alpha7-nAChR. The methodology developed combines liquid chromatography (LC) coupled via a split with both an at-line calcium (Ca(2+))-flux assay and high-resolution mass spectrometry (MS) PMID: 26738519 The authors propose a mechanism for the pathogenicity of CHRNA7 duplications of increased alpha7 Nicotinic Acetylcholine Receptor protein levels in the Endoplasmic Reticulum, resulting in Endoplasmic Reticulum stress and impaired chaperoning of alpha7 Nicotinic Acetylcholine Receptor subunits to the membrane. PMID: 29129316 Immunopositivity of alpha7-nAChR in granular layers was observed in most of the fetuses and infants in the control group (83%) and several victims of the SIUDS or SIDS groups (38% and 31%, respectively). On the contrary, low levels or total absence of alpha7-nAChR immunoexpression were detected in a wide subset (over 50% of the cases) of sudden fetal and infant deaths, which was highly related to maternal smoking. PMID: 28735558 alpha7nAChR activation inhibits the development of endometriosis by regulating inflammation. PMID: 27766701 level of alpha7 nAChR expression in the brain is critical for supporting the resistance to inflammatory and apoptogenic agents; the data presented may be a basis to create a new strategy for preventing and, possibly, slowing Alzheimer's disease development in humans PMID: 26818865 Activated alpha7nAChR exhibits extensive anti-inflammatory and immune modulatory reactions, including lowered pro-inflammatory cytokines levels, decreased expressions of chemokines as well as adhesion molecules, and altered differentiation and activation of immune cells, which are important in maintaining immune homeostasis. PMID: 28123345 Comprehensive phenotyping revealed high prevalence of developmental delay/intellectual disability, autism spectrum disorder, and attention deficit/hyperactivity disorder in children with microduplications involving CHRNA7. PMID: 27853923 These results support our previous study showing that these PAMs are selective for the alpha7 AChR, and clarify that the procognitive/promnesic/antidepressant activity of PAM-2 is not mediated by other targets. PMID: 27129924 Data (including data from studies conducted using knockout mice and SH-SY5Y cell line) suggest that Wnt/beta-catenin signaling is critical effector of CHRNA7-associated neuroprotection of dopaminergic neurons in substantia nigra; Parkinson's disease appears to develop without this neuroprotection. PMID: 28551099 Treatment of cells with nicotine induced the mRNA and protein levels of alpha7 nAChR; this could be abrogated by treatment with inhibitors targeting Src, PI3K, MEK, alpha7 nAChR, CDK4/6 or a disruptor of the Rb-Raf-1 interaction. PMID: 27228072 Study provides novel information on alpha7 potentiation: results show that positive allosteric modulators enhance open-channel lifetime and produce episodes of successive openings, thus indicating that both types affect alpha7 kinetics. Different positive allosteric modulators types show different sensitivity to temperature, suggesting different mechanisms of potentiation. PMID: 26926428 Activation of alpha7nAChR alleviates Ang II-induced vascular smooth muscle cell senescence by promoting NAD(+)-SIRT1 pathway. PMID: 27339462 We assume an additive effect of haploinsufficiency of ZBTB18 and CHRNA7 in our patient. Assembling the features of our patient and the published patients, we noted that only one of them showed mild anomalies of the corpus callosum. PMID: 28345786 the purified alpha7nAChR injected into Xenopus oocytes can be activated by acetylcholine, choline, and nicotine, inhibited by the channel blockers QX-222 and phencyclidine, and potentiated by the alpha7nAChR specific modulators PNU-120596 and TQS. PMID: 27385587 results demonstrate the anti-inflammatory role of alpha7 nAChR in NK cells and suggest that modulation of its activity in these cells may constitute a novel target for regulation of the immune response. PMID: 27284006 The current review summarizes information on receptor expression, the intracellular signaling pathways they modulate and reasons for receptor dysfunction. [review] PMID: 26979166 A7-nAChR may be a key biomarker for assessing the chemosensitivity of gastric cancer cells to taxane. PMID: 26499946 Gene expression levels of alpha7nAChR did not differ between groups; protein expression was significantly higher in chronic rhinosinusitis with nasal polyps than in chronic rhinosinusitis without nasal polyps, and both of these patient groups showed significant higher levels than controls. PMID: 26410356 Data also suggest that alpha7 nicotinic acetylcholine receptor (alpha7-nAChR) inhibition or targeting Snail may provide a feasible rationale for preventing the progression of HNSCC. PMID: 24986226 This review discusses the current literature on stroke-induced inflammation and the effects of CHRNA7 modulators on innate immune cells.[Review] PMID: 26690125 Promoter variant -194C (rs28531779) was significantly associated with schizophrenia, but not associated with P50 suppression or pre-pulse inhibition of the startle reflex. CHRNA7 promoter variants had elevated startle magnitude in pulse-alone trials. PMID: 26376812 A stronger alpha7nAChR immunoreactivity than seen for tenocytes was observed for the cells in the peritendinous tissue. PMID: 25981114 The purified alpha 7-nicotinic acetylcholine receptor samples displayed high thermal stability with a Tm of 60 degrees C. PMID: 26073323 This supports the hypothesis that the antiproliferative activity of SLURP-1 is related to 'metabotropic' signaling pathway through alpha7-nAChR, that activates intracellular signaling cascades without opening the receptor channel. PMID: 26905431 expression of chaperones such as Ric-3 can influence proteins associating with alpha7-nAChRs PMID: 26258666 14 single nucleotide polymorphisms cause missense mutations of human alpha7 nicotinic receptor exert a different functional impact. PMID: 26340537 It was concluded that the mechanism of alpha-bungarotoxin antagonism of CHRNA7 is non-competitive, originating from conformational arrest of the binding sites. PMID: 26282895 The CNV-3956 of CHRNA7 contributed to increased risks and poor prognoses of both COPD and lung cancer, and this may be a genetic biomarker of the two diseases. PMID: 25407004 The results clearly showed that depletion of A7-nAChR suppressed the drug sensitivity of gastric cancer cells to 5-FU treatment PMID: 26136123 Study explored the microscopic mechanisms underlying the interplay between the channel domains and the coupling interface that affect the channel activity, and generated an allosteric gating model for CHRNA7 PMID: 25908400 Data show preferential fetal CHRFAM7A expression in the human prefrontal cortex and suggest abnormalities in the CHRFAM7A/CHRNA7 ratios in schizophrenia and bipolar disorder, due mainly to overexpression of CHRFAM7A. PMID: 26206074 CHRNA7 variants may not contribute to autism spectrum disorder susceptibility. PMID: 25655306 analysis of different allosteric binding sites in the alpha7 nAChR PMID: 25918415 a7 nicotinic acetylcholine receptor signaling inhibits NLRP3 inflammasome activation by preventing mitochondrial DNA release PMID: 24849809 Our findings suggest that alpha7nAChR and MAPK signaling pathways play an important role in the uptake and accumulation of Abeta1-42 in SH-SY5Y cells. PMID: 25168732 There is an association between the CHRNA7 T allele and a better response to treatment with cholinesterase inhibitors in patients with mild AD. PMID: 24951635 However,[CHRNA7 promoter variant] -86T was significantly more frequent among patients with OCD (TS/OCD and TS/OCD/ADHD) compared to patients without OCD (TS-only and TS/ADHD) PMID: 25024057 Activation of CHRNA7 by nicotine reduced the Th17 response in CD4 positive T lymphocytes PMID: 24949556 Vagus nerve through alpha7 nAChR modulates lung infection and inflammation: models, cells, and signals. PMID: 25136575 This study reveals that alpha7 nicotinic acetylcholine receptor gene expression levels in peripheral blood mononuclear cells is a clinically relevant marker for cholinergic antiinflammatory pathway activity and clinical outcome in sepsis. PMID: 25092899 alpha7nAChR protein was detected on T cells and macrophages in surgical specimens of atherosclerotic plaques. PMID: 25324572 CHRNA17 triplication co-segregates with neuropsychiatric and cognitive phenotypes in three-generation pedigree. PMID: 24424125

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.