Recombinant Human Neuronal Acetylcholine Receptor Subunit Alpha-3 (CHRNA3) Protein (His)

Name: Recombinant Human Neuronal Acetylcholine Receptor Subunit Alpha-3 (CHRNA3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07967P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Neuronal Acetylcholine Receptor Subunit Alpha-3 (CHRNA3) Protein (His) is produced by our Baculovirus expression system. This is a extracellular protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P32297
Target Symbol	CHRNA3
Synonyms	ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	C-10His
Target Protein Sequence	SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Expression Range	32-240aa
Protein Length	Extracellular Domain
Mol. Weight	26.6 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-3/CHRNA3 sub-subfamily
Database References	HGNC: 1957 OMIM: 118503 KEGG: hsa:1136 STRING: 9606.ENSP00000315602 UniGene: Hs.89605

Gene Functions References

Frequency of the cholinergic receptor nicotinic alpha 5 (CHRNA5) rs16969968-A allele and cholinergic receptor nicotinic alpha 3 (CHRNA3) rs1051730-T allele were significantly higher in lung cancer than in normal controls. PMID: 29609626
Data indicate potential associations between CHRNA3polymorphisms and schizophrenia susceptibility, and the significant variants identified in our study may be used as genetic biomarkers for schizophrenia susceptibility in Chinese Han population PMID: 29879020
The rs13180 (IREB2), rs16969968 (CHRNA5) and rs1051730 (CHRNA3) were significantly associated with Chronic obstructive pulmonary disease (COPD) in additive model [Padj =0.00001, odds ratio (OR)=0.64; Padj =0.0001, OR=1.41 and Padj =0.0001, OR=1.47]. The C-G haplotype by rs13180 and rs1051730 was a protective factor for COPD in our population (Padj =0.0005, OR=0.61). PMID: 28474623
our results show that a genomic region with functionally related genes, such as the CHRNA5/CHRNA3/CHRNB4 cluster, is under coordinated regulatory control. PMID: 27758088
CHRNA3 genetic risk score was associated with successful smoking cessation in a Chinese rural population. PMID: 28191914
The minor allele increased the risk of COPD when compared to the population at large. Homozygosity for the risk allele was associated in both cohorts with all-cause mortality, with any type of cancer among the COPD patients and with the number of pack-years among the male smokers. PMID: 26751916
The results of this study suggests a pleiotropic role of Chr15q25 CHRNA5-CHRNA3-CHRNB4 gene cluster with complex influences in ADHD, tobacco smoking and cognitive performance. PMID: 27302872
both rs578776 and rs938682 of CHRNA3 were significantly associated with the susceptibility of lung cancer. PMID: 26831765
the association of 3 selected single-nucleotide polymorphisms (CHRNA3 rs1051730, rs6495308, and CHRNA5 rs55853898) with nicotine dependence in an isolated population of Kashubians from Poland, is reported. PMID: 27127891
CHRNA3 rs1051730 (G > A) and AGPHD1 rs8034191 (A > G) were more susceptible to lung cancers than noncarriers. PMID: 27072204
focus on the CHRNA5/A3/B4 gene cluster and its role in nicotine dependence (review) PMID: 25471942
At CHRNA3, allele G of rs3743078 was associated with increased nicotine craving. PMID: 26997181
Our data suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers. PMID: 26689306
two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors PMID: 26942719
CHRNA3 - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies. PMID: 26527870
Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers. PMID: 26010901
The positive interaction between heavy smoking and the homozygous mutant CHRNA3 rs6495308 genotype was found to affect the likelihood of hypertension in Chinese male smokers. PMID: 25874685
Four SNPs in the CHRNA3/5 locus are associated with chronic obstructive pulmonary disease risk. [Meta-analysis] PMID: 25051068
CHRNA5-A3-B4 genotype associates with body mass index in never smokers. PMID: 25474695
Of the 2305 SNPs identified in the CHRNA3 gene, 115 were found to be non-synonymous and 12 and 15 nsSNPs were found to be in the 5' and 3' UTRs, respectively. 115 nsSNPs investigated, eight were predicted to be deleterious by both SIFT and PredictSNP servers. PMID: 26002565
Our findings demonstrated that CHRNA3 gene rs6495309 polymorphism might be a risk factor for the development of lung cancer in Chinese. PMID: 25288178
Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities PMID: 25384568
the haplotype analysis found that the haplotypes "TCAC" and "CTGT," composed of rs938682, rs12914385, rs11637630, and rs2869546, were associated with a 1.79-fold and 501-fold increased lung cancer risk PMID: 25656608
The frequencies of genotype and allele in CHRNA3 (rs8040868) and PHACTR2 (rs9390123) were not significantly different between the NSCLC cases and controls, or between either of the subgroups. PMID: 25399010
GABRR2 and CHRNA3 were found to be differentially expressed after risperidone treatment. These genes may be regulated by antipsychotic use. PMID: 24113126
Suggest no relationship between these smoking-related SNPs in the CHRNA5/A3/B4 gene cluster and psoriasis vulgaris in Chinese Han population. PMID: 25297392
In Mendelian randomisation analyses, there was no strong evidence that the minor allele of rs16969968/rs1051730 was associated with depression, anxiety or psychological distress in current or former smokers. [Meta-analysis] PMID: 25293386
The alpha3beta4* nicotinic ACh receptor subtype mediates physical dependence to morphine PMID: 24750073
High cumulative tobacco consumption is associated with short telomeres observationally, but there is no clear genetic association. PMID: 24906368
Results show that CHRNA3 genotype is associated with decreased lung function and risk of chronic obstructive pulmonary disease. among ever-smokers, whereas this was not the case for CYP3A5*3. PMID: 24535486
Increased expression of NeuroD1 subsequently leads to regulation of expression and function of the nicotinic acetylcholine receptor subunit cluster of alpha3, alpha5, and beta4. PMID: 24719457
CHRNA3 polymorphism functions as a genetic modifier of the risk of developing lung ADC in the Chinese population, particularly in nonsmoking females. PMID: 24686516
The minor alleles of two polymorphisms (rs578776 and rs3743078) in the CHRNA3 gene are associated with an increased risk of tobacco smoking only among patients with ADHD. PMID: 24375168
Elucidation of the signaling events elicited upon agonist binding to corneal mAChRs and nAChRs will be crucial for understanding the mechanisms of ACh signaling in CECs, which has salient clinical implications. PMID: 25270189
rs1051730 polymorphism may modify susceptibility to lung cancer via a smoking-independent manner among Chinese Han population. PMID: 24337855
Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence. PMID: 24057674
Genetic variants in the CHRNA5-A3-B4 gene cluster alter nicotine intake and body mass index in a population of Alaska Native people, who have a distinct haplotype structure, smoking behaviors and prevalence of obesity. PMID: 23692359
Investigated associations between neuroticism and 13 SNPs in the CHRNA5 and CHRNA3 genes in young adult Mexican American men and women. PMID: 24588897
Women with the variant AA genotype of CHRNA3 rs578775 were at significantly decreased risk of heavy smoking. PMID: 21810735
study identified an association between a nicotinic acetylcholine receptor a3 subunit variant (rs578776)and reward-related neural response in a large cohort of healthy non-smoking adolescents. PMID: 23689675
Genetic variations in CHRNA3 are associated with COPD in the Korean population. PMID: 23207642
Genetic variation in nicotinic receptor gene CHRNA3 might be an important connecting link between early attentional processes and smoking behavior. PMID: 23604333
CHRNA3 gene rs3743073G variant genotype significantly increased lung cancer risk, especially in male smokers over the age of 60. PMID: 23023782
Rare genetic variation in the CHRNA5-A3-B4 gene cluster contributes modestly to the level of response to alcohol. PMID: 23458267
CHRNA5-A3-B4 rs667282 TT/TG genotypes were associated with significantly increased risk of esophageal squamous cell carcinoma. PMID: 23844051
CHRNA3 polymorphism was associated with pack-year of smoking in chronic obstructive pulmonary disease Chinese Han patients PMID: 22914670
Our findings uncover a novel mechanism of nicotine-induced alpha3beta4 nAChR upregulation that may be relevant also for other nAChR subtypes. PMID: 23884938
silencing alpha3 nAChR mRNA might enhance the effect of Abeta25-35 on cell apoptosis by increasing the levels of p38 protein and bax mRNA and decreasing the level of bcl-2 mRNA, which may play a role in the pathogenesis of Alzheimer's disease PMID: 23710919
SNP rs1051730 associated with smoking and body mass index PMID: 23729684
we evaluate the utility of genetic variants in CHRNA3 for smoking as a risk factor in low birth weight PMID: 23701534

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.