Recombinant Human Neurogenic Locus Notch Homolog Protein 1 (NOTCH1) Protein (His-GST&Myc)

Name: Recombinant Human Neurogenic Locus Notch Homolog Protein 1 (NOTCH1) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-01054P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Neurogenic Locus Notch Homolog Protein 1 (NOTCH1) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P46531
Target Symbol	NOTCH1
Synonyms	(Notch 1)(hN1)(Translocation-associated notch protein TAN-1)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Expression Range	2428-2555aa
Protein Length	Partial
Mol. Weight	48.7 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4(+) and CD8(+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO).
Subcellular Location	Cell membrane; Single-pass type I membrane protein.; [Notch 1 intracellular domain]: Nucleus.
Protein Families	NOTCH family
Database References	HGNC: 7881 OMIM: 109730 KEGG: hsa:4851 STRING: 9606.ENSP00000277541 UniGene: PMID: 29269413 Expression of translocation-associated notch protein (Notch1) is elevated in patients with chronic hepatitis C (HCV). Inhibition of Notch signaling downregulates HCV-specific Th22 cells and interleukin-22 production, which is accompanied by the reduction of aryl hydrocarbon receptor and modulatory cytokines (IL-6 and tumor necrosis factor-alpha). PMID: 28410452 MiR-497 approximately 195 cluster regulates angiogenesis during coupling with osteogenesis by maintaining endothelial Notch1 and HIF1A activity. PMID: 28685750 The results demonstrated that treatment with norepinephrine(NE) enhanced cell viability and invasion, and inhibited apoptosis of Pancreatic ductal adenocarcinoma (PDAC) cells; however, these effects were suppressed following treatment with Notch1specific siRNA and DAPT. In conclusion, NE may enhance the malignant biological behaviors of PDAC via activating the Notch1 pathway. PMID: 30226612 sinonasal inverted papillomas lesions presented reduced Notch-1 expression compared to nasal polyposis. Dysplastic lesions presented low Notch-1 immunopositivity. Enhancement of Notch-1 gene expression was also associated with inflammation. PMID: 30297114 NOTCH signalling can modulate chromatin structure autonomously and non-autonomously. PMID: 29743479 Notch1 activation and epithelial-mesenchymal transition are coupled to promote squamous cell carcinomas tumor initiation in concert with transforming growth factor (TGF)-beta present in the tumor microenvironment. PMID: 29170450 the reported Dowling-Degos mutations of POFUT1, except for M262T, fail to rescue Notch1 signaling efficiently in the CRISPR-engineered POFUT1-/- background; these studies identify POFUT1 as a potential target for cancers driven by Notch1 mutations and provide a structural roadmap for its inhibition PMID: 28334865 Study reports that IL-17 stimulation induces NOTCH1 activation in oligodendrocyte progenitor cells, contributing to Th17-mediated demyelinating disease. PMID: 28561022 High NOTCH1 expression is associated with endometriosis. PMID: 29398419 Mir-34a regulates cigarette smoke extract-induced respiratory endothelial cell apoptosis by targeting Notch-1 protein. PMID: 29373969 shear stress was able to induce arterial endothelial differentiation of stem cells from human exfoliated deciduous teeth, and VEGF-DLL4/NotchEphrinB2 signaling was involved in this process. PMID: 30015843 Notch1 receptor intracellular domain and Ets-1 cooperatively bind to the DNA of the TRPA1 promoter to up-regulate transcription in the context of living cells. PMID: 28220825 miR-139-5p was identified as a tumour suppressor by negatively targeting Notch1, and this work suggests a possible molecular mechanism of the miR-139/Notch1/EMT axis for glioma treatment. PMID: 30170559 Data suggest that CBX4 expression is up-regulated in breast cancer and is correlated with unfavorable overall survival; CBX4 promotes cell growth and migration via transcriptionally suppressing expression of miR137 to trigger Notch1 signaling pathway. (CBX4 = chromobox homolog 4; miR137 = microRNA 137; Notch1 = neurogenic locus notch homolog protein-1) PMID: 29229426 Data indicate that stanniocalcin 1 (STC1) is a non-canonical NOTCH1 ligand and acts as a crucial regulator of stemness in glioblastoma (GBM). PMID: 29196129 showed here that 3' UTR NOTCH1 mutations are associated with low CD20 expression and with relative resistance to anti-CD20 immunotherapy in vitro PMID: 28550186 MiR92a3p blocks the progression of Wilms tumor by targeting NOTCH1. PMID: 29845267 identified a branch of the XIST/miR-137/Notch-1 pathway that regulates proliferation and TGF-beta1-induced EMT in NSCLC, which could be involved in NSCLC progression PMID: 29812958 In conclusion, we demonstrated that EV71 infection induced elevated expressions of TLR3/4 and Notch1/2 in CD14+ monocytes. PMID: 29702280 Data show that fluid shear stress activates NOTCH signaling, which upregulates GJA4 (commonly, Cx37) and downstream cell cycle inhibitor CDKN1B (p27). PMID: 29247167 EZH2 mutations coexisted with mutations of NOTCH1, IL7R, and PHF6 in the two Adult T-cell Acute Lymphoblastic Leukemia patients, and they responded poorly to chemotherapy and experienced difficult clinical histories and inferior outcomes PMID: 28747286 Crosstalk between TLR4 and Notch1 signaling regulates the inflammatory response in the IgAN and maybe plays an important role in the progression of IgAN. PMID: 29230705 These results suggest that gastric cancer progression is not associated with a unique signaling pathway and that a feedback loop may exist between the HGF/c-Met and Notch1 signaling pathways, which may result in therapeutic resistance. PMID: 29781036 Results indicated that CRNDE functioned as an oncogene in osteosarcoma cell lines, and CRNDE may exert its oncogenic role via regulating Notch1 signaling and EMT in osteosarcoma. PMID: 29246789 NOTCH1 is a central mediator of TGFbetamediated FOXP3 expression and NOTCH1 inhibition produces a significant reduction of melanoma cell proliferation and viability. PMID: 29620159 Study observed membranous Notch1 expression in 31% of the oral leukoplakia (OL) samples. Membranous Notch1 expression was significantly associated with the severity of dysplasia and development of oral squamous cell carcinoma (OSCC). Also, the extent of membranous Notch1 expression was found to increase during carcinogenesis. PMID: 29620248 High NOTCH1 expression is associated with head and neck squamous cell carcinoma. PMID: 29047105 Notch1 role in the angiomyolipoma differentiation.Rheb transcription is regulated by direct Notch1 binding to the Rheb promoter. PMID: 29184052 Notch1 signaling may contribute to the pathogenesis of PV by regulating Th17/Treg immune imbalance. PMID: 29686529 we demonstrate for the first time the presence of NOTCH1 mutation in cases of Hodgkin transformation of B-CLL and outline the clinicopathological characteristics and treatment outcomes for these patients. PMID: 27686521 Endothelial NOTCH1 is responsive to shear stress, and is necessary for the maintenance of junctional integrity, cell elongation, and suppression of proliferation, phenotypes induced by laminar shear stress. PMID: 29158473 Notch1 activation in glioma stem cells specifically induces expression of the long noncoding RNA, TUG1. PMID: 27922002 B-AP15 induced cytotoxic response to hepatocellular carcinoma cells by augmenting ER stress/UPR and inhibiting Wnt/Notch1 signaling pathways. PMID: 29454609 Notch1 is a direct target of miR-449a and positively regulated by circRNA-000911 in breast cancer cell lines. PMID: 29431182 human thymopoiesis involves complex spatiotemporal regulation of Notch ligand expression, which ensures the coordinated delivery of niche-specific NOTCH1 signals required for dynamic T-cell development. PMID: 30042180 Notch1 was confirmed as a target of miR1395p and, showed a marked downregulated expression together with its pathway downstream factors during mesenchymal stem cells osteogenesis. PMID: 29565453 High expression of NOTCH1 was associated with better overall survival in head and neck squamous cell carcinoma. PMID: 29533972 This study identifies the unique role of JAG1-induced Notch activation in the pathogenesis of multiple myeloma PMID: 29242532 Results indicate that lncRNA SNHG1 may be a potential predictor of prognosis in esophageal squamous cell cancer (ESCC) patients, and that knockdown of SNHG1 suppressed the Notch signaling pathway by reducing the Notch1 expression levels in ESCC cells. PMID: 29081407 ATRX, NOTCH1 and NOTCH2 expression varies in angiosarcomas and shows significant correlations with site of origin and poor clinical outcome PMID: 28796347 CK2 inhibitor CX-4945 destabilizes NOTCH1 and synergizes with JQ1 against human T-acute lymphoblastic leukemic cells. PMID: 27758824 Western blotting demonstrated that DUSP1 dephosphorylated pERK and PTEN dephosphorylated pAKT. Collectively, we found a link among HBx, the Notch1 pathway, DUSP1/PTEN, and ERK/AKT pathways, which influenced hepatocellular carcinoma (HCC) cell survival and could be a therapeutic target for HCC treatment. PMID: 29048612 Notch 1 was key in the progression of breast cancer, and knocking down the expression of Notch 1 significantly suppressed the proliferation and invasion of breast cancer cells. PMID: 29207146 Results provide insight into the interrelationship between T-ALL oncogenic networks and the therapeutic efficacy of dual PI3Kgamma/delta inhibition in the context of NOTCH1 and cMYC signaling. PMID: 28716817 Notch1 signaling is an essential downstream pathway of MDM2 in mediating high glucose-induced mitotic catastrophe in podocytes. PMID: 28643424 Effect of Notch1 gene on proliferation and chemo sensitivity of lung cancer A549 cells was studied. PMID: 28678318 results indicate that an ATP2C1/NOTCH1 axis might be critical for keratinocyte function and cutaneous homeostasis, suggesting a plausible model for the pathological features of Hailey-Hailey disease PMID: 27528123 MAFB enhanced leukemogenesis by the naturally occurring Notch1 mutants, decreased disease latency, and increased disease penetrance. PMID: 29138297 the tumorsuppressive roles of miR455 in modulating EOC proliferation and invasion through regulation of Notch1 expression. PMID: 29039517

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.