Recombinant Human Neural Cell Adhesion Molecule L1 (L1CAM) Protein (His)

Name: Recombinant Human Neural Cell Adhesion Molecule L1 (L1CAM) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11152P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Neural Cell Adhesion Molecule L1 (L1CAM) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P32004
Target Symbol	L1CAM
Synonyms	Antigen identified by monoclonal R1 ; CAML1; CD171; CD171 antigen ; HSAS; HSAS1; Hyd; L1; L1 cell adhesion molecule; L1-NCAM; L1cam; L1CAM_HUMAN; MASA; MIC5; N CAML1 ; N-CAM-L1; NCAM-L1; NCAML1; Nerve-growth factor-inducible large external glycoprotein; Neural cell adhesion molecule L1; NILE; OTTHUMP00000025992 ; S10 ; SPG1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP
Expression Range	1003-1114aa
Protein Length	Partial
Mol. Weight	16.5kDa
Research Area	Cell Adhesion
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Neural cell adhesion molecule involved in the dynamics of cell adhesion and in the generation of transmembrane signals at tyrosine kinase receptors. During brain development, critical in multiple processes, including neuronal migration, axonal growth and fasciculation, and synaptogenesis. In the mature brain, plays a role in the dynamics of neuronal structure and function, including synaptic plasticity.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell projection, growth cone. Cell projection, axon. Cell projection, dendrite.
Protein Families	Immunoglobulin superfamily, L1/neurofascin/NgCAM family
Database References	HGNC: 6470 OMIM: 303350 KEGG: hsa:3897 STRING: 9606.ENSP00000359074 UniGene: PMID: 30140948 Our findings suggest that L1CAM is possibly involved in the pathogenesis of at least a subset of endometrial clear cell carcinomas PMID: 28941294 The directional force for laminin-induced growth cone haptotaxis is generated by the grip and slip of L1-CAM on the substrates, which occur asymmetrically under the growth cone. PMID: 29483251 L1CAM promotes esophageal squamous cell carcinoma tumorigenicity by upregulating ezrin expression. PMID: 28939985 TWIST1, in part via GAS6 and L1CAM, led to higher expression and activation of Akt upon cisplatin treatment, and inhibition of Akt activation sensitized cells to cisplatin. PMID: 27876874 data make L1CAM a highly interesting therapeutic target to prevent further metastatic spread in melanoma patients PMID: 29432466 High circulating levels of autoantibodies against L1-cell adhesion molecule is associated with esophageal squamous cell carcinoma. PMID: 28181176 A functional role for L1CAM in extrahepatic cholangiocarcinoma carrying the activating KRAS mutation.L1CAM prmotes cell migration and invasion via JNK activation in extrahepatic cholangiocarcinoma. PMID: 28535665 this review and meta-analysis concludes that L1CAM might be an effective poor prognostic factor for patients with various tumor types PMID: 27833079 High L1CAM expression is associated with vulvar squamous cell carcinomas. PMID: 27028855 Our preclinical assessment of the CE7 epitope on CD171 supports its utility and safety as a CAR T-cell target for neuroblastoma immunotherapy PMID: 27390347 L1CAM may have a role in human endometrial cancer and miR-34a has an inverse role to L1CAMEXP PMID: 27233077 L1CAM mRNA expression appears to play a substantial role in the pathophysiology of ovarian cancer that is translated into poor clinical outcome. PMID: 27174921 These results suggest that a deficiency in L1 may partially account for RTT phenotypes. PMID: 29050935 L1CAM failed to be a clinically relevant marker of poor prognosis in stage I endometrioid endometrial carcinoma PMID: 27488577 This study revealed an unexpected role of L1CAM in the pathological crosstalk between the immune and nervous systems. PMID: 27544757 Mutations involving L1 cell adhesion molecule is associated with chemotherapy-resistant urothelial carcinoma. PMID: 27749842 Data suggest that targeted therapy to neural cell adhesion molecule L1 (L1) might be effective in the treatment of retinoblastoma tumors. PMID: 28061460 CD10 is a necessary component conferring the L1 effects in CRC cells. The identification of gene expression patterns of L1-domain-specific point mutations may provide novel markers and targets for interfering with L1-mediated CRC progression. PMID: 27641335 High L1-CAM expression is associated with low radiosensitivity in neuroblastoma. PMID: 27432152 Neural cell adhesion molecule L1 (L1CAM)-mediated cell-cell aggregation was severely impaired by L1CAM variants p.I37N, p.M172I and p.D202Y but was preserved by the variant p.T38M. PMID: 26891472 The differential expression timing of CD184 and CD171 permits identification and enrichment of RGCs from retinal organoids at differing maturation states from committed progenitors to differentiating neurons. PMID: 27867005 This study examined the spatiotemporal distribution of L1CAM in the early human fetal period by means of immunohistochemistry and in situ hybridization. In advanced differentiated epithelia such as those of the gastrointestinal system, L1CAM localization vanishes. In epithelia, however, which undergo further development such as those of the urogenital system, L1CAM is further needed for their fully establishment. PMID: 28026654 The expression of L1CAM was associated with advanced stage, nodal involvement, high tumour grade, non-endometrioid histology, lymphovascular space invasion, and distant recurrences in all cases, and with reduced survival in the endometrial carcinomas, but not in the non-endometrioid carcinomas. L1CAM may induce EMT-like changes, but seems to only play a role in metastasis, not in invasion. PMID: 27505134 L1CAM expression is an independent predictor of poor survival in endometrial cancer, and is associated with advanced stage, high-risk endometrial cancer. PMID: 26861585 L1CAM is a neuronal cell adhesion molecule involved in the development of the nervous system and progression of malignancies. (Review) PMID: 27267927 Splicing variant c.1267+5delG was identified in fetal hydrocephalus. The same mutation and severe L1 syndrome was confirmed in the second pregnancy. PMID: 27207492 Involvement of L1CAM in the regulation of activity of the canonical Wnt pathway and expression of genes of class I melanoma-associated antigens in melanoma. PMID: 27165065 L1CAM was a significant independent prognosticator for disease-specific survival in endometrial carcinoma. PMID: 27695947 Report high frequency of L1CAM expression in high-risk endometrial cancers associated with mutant p53 expression. PMID: 26743472 L1CAM is frequently expressed in testicular germ cell tumors but not in normal testis. PMID: 26933044 L1 syndrome should be considered in the differential diagnosis of intellectual disability or mental retardation in children, especially when other signs such as hydrocephalus or adducted thumbs are present. PMID: 25948108 Genes induced during L1-mediated colorectal cancer cell metastasis PMID: 26399194 Our results suggest that the overexpression of L1CAM may be related to several established markers of poor prognosis in breast cancer patients. PMID: 26464672 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets PMID: 26478212 the CE7-epitope of L1-CAM is a cell adhesion molecule aberrantly expressed in several cancers and may have a role in immunotherapy PMID: 26761817 novel missense variant in L1CAM was identified in two Caucasian families with mild-moderate intellectual disability without obvious L1 syndrome features PMID: 25934484 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes L1CAM. PMID: 25666757 Our findings establish Slug-induced L1CAM expression as a mediator of a chemoresistant and migratory phenotype in pancreatic adenocarcinoma cells. PMID: 25860483 the expression level of L1CAM were negatively correlated with miR-503 levels in osteosarcoma tissues. PMID: 25536034 L1CAM is expressed in triple-negative breast cancers and is inversely correlated with androgen receptor PMID: 25510351 a positive relationship between L1 and pPKD1 in both cultured cerebellar neurons and human cerebellar tissue, suggesting that L1 functions in the modulation of PKD1 phosphorylation. PMID: 25445362 This indicates that similar biofunctionalization approaches based on N-cadherin and L1 can be translated to 3-D "transplantable" scaffolds with enhanced neurotrophic behaviors. PMID: 24914828 Findings shed new light on the complex regulation of L1CAM in cancers and advocate the use of L1CAM/miR-21-3p for diagnostic application. PMID: 25149066 The data show that L1CAM promotes the enrichment of immunosuppressive T cells in particular of a CD4(+)CD25(-)CD69(+)-phenotype in pancreatic ductal adenocarcinoma providing a novel mechanism of tumor immune escape which contributes to tumor progression. PMID: 24746181 Data suggest that miR-34a can regulate L1CAM expression by targeting L1CAM mRNA for degradation. PMID: 24497324 Data indicate that positive L1 cell adhesion molecule (L1CAM) expression was significantly correlated with risk of distant recurrence. PMID: 25126672 Overexpression of L1CAM is associated with tumor progression via ERK signaling in gastric cancer. PMID: 24046108 Expression of L1CAM and EPCAM in gastric cancer was significantly associated with lymph node and distant metastasis, and poor prognosis. PMID: 24422715 Human pathological H210Q, R184Q and Y1070C, but not the E309K and L120V L1CAM mutations affect outside-in signaling via the FIGQY Ankyrin binding domain which is required for synapse formation. PMID: 24155914

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Neural Cell Adhesion Molecule L1 (L1CAM) Protein (His)

Recombinant Human Neural Cell Adhesion Molecule L1 (L1CAM) Protein (His)

Product Overview

Target Details

FAQs