Recombinant Human Nectin-2 (NECTIN2) Protein (His)

Name: Recombinant Human Nectin-2 (NECTIN2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08784P
Price: 418.4 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nectin-2 (NECTIN2) Protein (His) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q92692
Target Symbol	NECTIN2
Synonyms	CD 112; CD112; CD112 antigen; Herpes virus entry mediator B; Herpes virus entry protein B; Herpesvirus entry mediator B; Herpesvirus entry protein B; Hve B; HveB; Nectin-2; Nectin2; Poliovirus receptor like 2; Poliovirus receptor related 2 (herpesvirus entry mediator B); Poliovirus receptor related 2; Poliovirus receptor related protein 2; Poliovirus receptor-related protein 2; PRR 2; PRR2; PVRL 2; PVRL2; PVRL2_HUMAN; PVRR 2; PVRR2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Expression Range	32-360aa
Protein Length	Extracellular Domain
Mol. Weight	39.2kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein.; (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV).
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Protein Families	Nectin family
Database References	HGNC: 9707 OMIM: 600798 KEGG: hsa:5819 STRING: 9606.ENSP00000252483 UniGene: Hs.655455
Tissue Specificity	Ubiquitous.

Gene Functions References

Nectin-2 mutation in men with severe teratospermia PMID: 28689229
In the infection with 3 MLD50 (50 % mouse lethal dose), effective resistance was not observed in transgenic mice expressing nectin-2Ig. PMID: 28671524
Our data provide important structural and biochemical determinants responsible for the recognition of nectin-2 by TIGIT. PMID: 27978489
Chromosomal breakpoints involved the PVRR2 gene in 19q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
energetic basis for the TIGIT/nectin-2 interaction and revealed that an "aromatic key" of nectin-2 is critical for this interaction, whereas variations in the lock were tolerated. PMID: 28515320
PVRL2 is a plasma cholesterol-responsive gene acting at endothelial sites of vascular inflammation to regulate transendothelial migration of leukocytes. PMID: 28062492
Serum levels of nectin-2 may have diagnostic roles for colorectal cancer patients. PMID: 26184725
Soluble form of nectin-2 is required for exerting the resistance against HSV-2 infection. PMID: 26982466
PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation. PMID: 24116228
Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of nectin 2, which increases the endothelial permeability in the coculture system. PMID: 23465821
Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion. PMID: 22927415
a possible etiologic role of PRR2 in nonsyndromic cleft lip with or without cleft palate PMID: 20662561
The CD112 is highly expressed in colon carcinoma tissues and cell lines. PMID: 20617580
The authors now show that human cytomegalovirus targets CD112 for proteasome-mediated degradation by 48 h post-infection, thus removing both activating ligands for DNAM-1 from the cell surface during productive infection. PMID: 20410314
differences in the N termini of herpes simplex virus type 1 and 2 gDs that influence functional interactions with the human entry receptor Nectin-2 PMID: 12915581
There is an allelic association of sequence variation in PVRL2 and the severity of multiple sclerosis. PMID: 16738668
CD226/CD112 (DNAM-1/Nectin-2) mast cell stimulation has a role in the allergic process PMID: 16831868
identified PVRL2 as a new recurrent partner gene of the [email protected] locus in peripheral T-cell lymphoma PMID: 17696193
Crystallization and preliminary X-ray analysis of the V domain of human nectin-2 are reported. PMID: 19478445
Regions of nectin-2 protein important for herpesvirus entry activity and homotypic nectin-nectin interactions are overlapping but not identical. PMID: 12438620

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.