Recombinant Human Nectin-2 (NECTIN2) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05632P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Nectin-2 (NECTIN2) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05632P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Nectin-2 (NECTIN2) Protein (His), Active is produced by our Mammalian cell expression system. This is a extracellular protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human DNAM-1 in functional ELISA is less than 10 ug/ml. |
Uniprotkb | Q92692 |
Target Symbol | NECTIN2 |
Synonyms | CD 112; CD112; CD112 antigen; Herpes virus entry mediator B; Herpes virus entry protein B; Herpesvirus entry mediator B; Herpesvirus entry protein B; Hve B; HveB; Nectin-2; Nectin2; Poliovirus receptor like 2; Poliovirus receptor related 2 (herpesvirus entry mediator B); Poliovirus receptor related 2; Poliovirus receptor related protein 2; Poliovirus receptor-related protein 2; PRR 2; PRR2; PVRL 2; PVRL2; PVRL2_HUMAN; PVRR 2; PVRR2 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-6His |
Complete Sequence | QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG |
Expression Range | 32-360aa |
Protein Length | Extracellular Domain |
Mol. Weight | 36.58 kDa |
Research Area | Immunology |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein.; (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV). |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Nectin family |
Database References | |
Tissue Specificity | Ubiquitous. |
Gene Functions References
- Nectin-2 mutation in men with severe teratospermia PMID: 28689229
- In the infection with 3 MLD50 (50 % mouse lethal dose), effective resistance was not observed in transgenic mice expressing nectin-2Ig. PMID: 28671524
- Our data provide important structural and biochemical determinants responsible for the recognition of nectin-2 by TIGIT. PMID: 27978489
- Chromosomal breakpoints involved the PVRR2 gene in 19q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
- energetic basis for the TIGIT/nectin-2 interaction and revealed that an "aromatic key" of nectin-2 is critical for this interaction, whereas variations in the lock were tolerated. PMID: 28515320
- PVRL2 is a plasma cholesterol-responsive gene acting at endothelial sites of vascular inflammation to regulate transendothelial migration of leukocytes. PMID: 28062492
- Serum levels of nectin-2 may have diagnostic roles for colorectal cancer patients. PMID: 26184725
- Soluble form of nectin-2 is required for exerting the resistance against HSV-2 infection. PMID: 26982466
- PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
- Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation. PMID: 24116228
- Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of nectin 2, which increases the endothelial permeability in the coculture system. PMID: 23465821
- Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion. PMID: 22927415
- a possible etiologic role of PRR2 in nonsyndromic cleft lip with or without cleft palate PMID: 20662561
- The CD112 is highly expressed in colon carcinoma tissues and cell lines. PMID: 20617580
- The authors now show that human cytomegalovirus targets CD112 for proteasome-mediated degradation by 48 h post-infection, thus removing both activating ligands for DNAM-1 from the cell surface during productive infection. PMID: 20410314
- differences in the N termini of herpes simplex virus type 1 and 2 gDs that influence functional interactions with the human entry receptor Nectin-2 PMID: 12915581
- There is an allelic association of sequence variation in PVRL2 and the severity of multiple sclerosis. PMID: 16738668
- CD226/CD112 (DNAM-1/Nectin-2) mast cell stimulation has a role in the allergic process PMID: 16831868
- identified PVRL2 as a new recurrent partner gene of the [email protected] locus in peripheral T-cell lymphoma PMID: 17696193
- Crystallization and preliminary X-ray analysis of the V domain of human nectin-2 are reported. PMID: 19478445
- Regions of nectin-2 protein important for herpesvirus entry activity and homotypic nectin-nectin interactions are overlapping but not identical. PMID: 12438620