Recombinant Human Nav1.5/SCN5A Protein
Beta LifeScience
SKU/CAT #: BLA-6079P
Recombinant Human Nav1.5/SCN5A Protein
Beta LifeScience
SKU/CAT #: BLA-6079P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q86V90 |
Synonym | Cardiac tetrodotoxin insensitive voltage dependent sodium channel alpha subunit CDCD2 CMD1E CMPD2 HB1 HB2 HBBD HH1 ICCD IVF LQT3 PFHB1 Scn5a Scn5a (gene name) SCN5A_HUMAN Sodium channel protein cardiac muscle alpha subunit Sodium channel protein cardiac muscle subunit alpha Sodium channel protein type 5 subunit alpha Sodium channel protein type V alpha subunit Sodium channel protein type V subunit alpha SSS1 VF1 Voltage gated sodium channel alpha subunit Nav1.5 Voltage-gated sodium channel subunit alpha Nav1.5 |
Description | Recombinant Human Nav1.5/SCN5A Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEE APRPQLDLQASKKLPDLYGNPPQELIGEPLEDLDPFYSTQKTFIVLNKGK TIFRFSATNALYVLSPFHPIRRAAVKILVHSLFNMLIMCTILTNCVFMAQ HDPPPWTKYVEYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNWLDFSV IIMAASVLGTLFFPMSIQATSTS |
Molecular Weight | 52 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |