Recombinant Human Nad-Dependent Malic Enzyme, Mitochondrial Protein (ME2) Protein (His), Active

Name: Recombinant Human Nad-Dependent Malic Enzyme, Mitochondrial Protein (ME2) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05561P
Availability: InStock

Collections: All products, Featured enzyme molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nad-Dependent Malic Enzyme, Mitochondrial Protein (ME2) Protein (His), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE and HPLC.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM
Uniprotkb	P23368
Target Symbol	ME2
Synonyms	Malate dehydrogenase; Malic enzyme 2; Malic enzyme 2 mitochondrial; Malic enzyme 2 NAD(+) dependent mitochondrial; Malic enzyme mitochondrial; Malic enzyme NAD(+) dependent mitochondrial; MAOM_HUMAN; ME 2; ME2; mitochondrial; NAD dependent malic enzyme mitochondrial; NAD ME; NAD-dependent malic enzyme; NAD-ME; ODS1; Pyruvic malic carboxylase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-6His
Complete Sequence	MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH
Expression Range	19-584aa
Protein Length	Full Length of Mature Protein
Mol. Weight	64.4 kDa
Research Area	Signal Transduction
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2μm filtered PBS, pH 7.4.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Mitochondrion matrix.
Protein Families	Malic enzymes family
Database References	HGNC: 6984 OMIM: 154270 KEGG: hsa:4200 STRING: 9606.ENSP00000321070 UniGene: PMID: 27166188 deletion of malic enzyme 2 confers collateral lethality in pancreatic cancer PMID: 28099419 Data indicate that malic enzyme 2 knockdown impacts phosphatidylinositol 3-kinases/proto-oncogene protein akt (PI3K/AKT) signaling. PMID: 24957098 ME2 might be an important factor in melanoma progression and a novel biomarker of invasion. PMID: 25202825 Three SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myclonic epilepsy. PMID: 23756480 Depletion of malic enzyme 2 induced erythroid differentiation in human erythroleukemia cells. PMID: 20824065 An ME2-centered nine-SNP haplotype, when present homozygously, increases the risk for IGE (odds ratio 6.1; 95% confidence interval 2.9-12.7) compared with any other genotype PMID: 15532013 Site directed mutagenesis was used to detrmine which amino acids in the active site of human mitochondrial NAD+-dependent malic enzyme are necessary for the inhibitory effects of ATP. PMID: 16171388 These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes. PMID: 17418816 Schizophrenic subjects are identified with mitochondrial genes involved in oxidative metabolism as showing consistently decreased expression, including ME2. PMID: 17638511 Single nucleotide polymorphism in ME2 gene is associated with acute lymphoblastic leukemia. PMID: 19066393 ME2 activity in Islets of Langerhans cells was measured by a spectrophotometric enzyme assay by utilizing the distinct kinetic properties. PMID: 19691144

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.