Recombinant Human Nad-Dependent Malic Enzyme, Mitochondrial Protein (ME2) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05561P
Recombinant Human Nad-Dependent Malic Enzyme, Mitochondrial Protein (ME2) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05561P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Nad-Dependent Malic Enzyme, Mitochondrial Protein (ME2) Protein (His), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE and HPLC. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM |
| Uniprotkb | P23368 |
| Target Symbol | ME2 |
| Synonyms | Malate dehydrogenase; Malic enzyme 2; Malic enzyme 2 mitochondrial; Malic enzyme 2 NAD(+) dependent mitochondrial; Malic enzyme mitochondrial; Malic enzyme NAD(+) dependent mitochondrial; MAOM_HUMAN; ME 2; ME2; mitochondrial; NAD dependent malic enzyme mitochondrial; NAD ME; NAD-dependent malic enzyme; NAD-ME; ODS1; Pyruvic malic carboxylase |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | C-6His |
| Complete Sequence | MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH |
| Expression Range | 19-584aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 64.4 kDa |
| Research Area | Signal Transduction |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2μm filtered PBS, pH 7.4. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Subcellular Location | Mitochondrion matrix. |
| Protein Families | Malic enzymes family |
| Database References | HGNC: 6984 OMIM: 154270 KEGG: hsa:4200 STRING: 9606.ENSP00000321070 UniGene: PMID: 27166188 |
