Recombinant Human Myosin Regulatory Light Polypeptide 9 (MYL9) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05703P
Recombinant Human Myosin Regulatory Light Polypeptide 9 (MYL9) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05703P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Myosin Regulatory Light Polypeptide 9 (MYL9) Protein (His), Active is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody , the EC50 is 4.628-6.430 ng/mL. |
| Uniprotkb | P24844 |
| Target Symbol | MYL9 |
| Synonyms | 20 kDa myosin light chain; LC20; MLC-2C; Myosin RLC; Myosin regulatory light chain 2, smooth muscle isoform; Myosin regulatory light chain 9; Myosin regulatory light chain MRLC1 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | C-10His |
| Target Protein Sequence | SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
| Expression Range | 2-172aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 21.7kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. In myoblasts, may regulate PIEZO1-dependent cortical actomyosin assembly involved in myotube formation. |
| Subcellular Location | Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. |
| Database References | HGNC: 15754 OMIM: 609905 KEGG: hsa:10398 STRING: 9606.ENSP00000279022 UniGene: PMID: 28388691 |
