Recombinant Human Myosin Light Polypeptide 6 (MYL6) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03601P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Myosin Light Polypeptide 6 (MYL6) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03601P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Myosin Light Polypeptide 6 (MYL6) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P60660 |
| Target Symbol | MYL6 |
| Synonyms | 17 kDa myosin light chain; ESMLC; LC 17; LC17; LC17 GI; LC17 NM; LC17A; LC17B; MLC 3; MLC-3; MLC1SM; MLC3; MLC3NM; MLC3SM; MYL 6; MYL6; MYL6_HUMAN; Myosin light chain 3; Myosin light chain 6 alkali smooth muscle and non muscle; Myosin light chain A3; Myosin light chain alkali 3; Myosin light polypeptide 6 alkali smooth muscle and non muscle; Myosin light polypeptide 6; Smooth muscle and non muscle myosin alkali light chain; Smooth muscle and nonmuscle myosin light chain alkali 6 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG |
| Expression Range | 3-151aa |
| Protein Length | Partial |
| Mol. Weight | 43.7kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Regulatory light chain of myosin. Does not bind calcium. |
| Database References |
