Recombinant Human Myosin-7 (MYH7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06901P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Myosin-7 (MYH7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06901P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Myosin-7 (MYH7) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P12883 |
| Target Symbol | MYH7 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | C-6His |
| Target Protein Sequence | MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY |
| Expression Range | 1-109aa |
| Protein Length | Partial |
| Mol. Weight | 18.1 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Forms regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle. |
| Subcellular Location | Cytoplasm, myofibril. Cytoplasm, myofibril, sarcomere. |
| Protein Families | TRAFAC class myosin-kinesin ATPase superfamily, Myosin family |
| Database References | HGNC: 7577 OMIM: 160500 KEGG: hsa:4625 STRING: 9606.ENSP00000347507 UniGene: PMID: 29386531 |
