Recombinant Human Myocardin-Related Transcription Factor A (MKL1) Protein (His-KSI)

Name: Recombinant Human Myocardin-Related Transcription Factor A (MKL1) Protein (His-KSI)
Brand: Beta LifeScience
SKU: BLC-01980P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Myocardin-Related Transcription Factor A (MKL1) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q969V6
Target Symbol	MKL1
Synonyms	MKL/myocardin-like protein 1 (Megakaryoblastic leukemia 1 protein) (Megakaryocytic acute leukemia protein)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-KSI
Target Protein Sequence	LHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKE
Expression Range	400-500aa
Protein Length	Partial
Mol. Weight	25.4 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription coactivator that associates with the serum response factor (SRF) transcription factor to control expression of genes regulating the cytoskeleton during development, morphogenesis and cell migration. The SRF-MRTFA complex activity responds to Rho GTPase-induced changes in cellular globular actin (G-actin) concentration, thereby coupling cytoskeletal gene expression to cytoskeletal dynamics. MRTFA binds G-actin via its RPEL repeats, regulating activity of the MRTFA-SRF complex. Activity is also regulated by filamentous actin (F-actin) in the nucleus.
Subcellular Location	Cytoplasm. Nucleus.
Database References	HGNC: 14334 OMIM: 606078 KEGG: hsa:57591 STRING: 9606.ENSP00000347847 UniGene: PMID: 29807221 The data identify the GEF Bcr as a regulator of RhoA/MAL signaling in keratinocytes, which in turn promotes differentiation through the desmosomal cadherin Dsg1. PMID: 23940119 the tumor suppressive role of miR-219a-5p in regulating breast cancer migration by targeting MRTF-A. PMID: 29077787 HDAC4 stimulates MRTF-A expression and drives fibrogenesis in hepatic stellate cells by targeting miR-206 PMID: 28548935 MRTF-A is required for proliferation and formation of mammary acini from luminal epithelial cells. Conversely, elevated MRTF activity results in pre-malignant spheroid formation due to defective proliferation, polarity loss and epithelial-mesenchymal transition. PMID: 28592291 MRTF-A regulated the transcriptional activity of Nrf2 by forming a complex with SRF binding to the CarG box which existed on Nrf2 promoter region, increasing the resistance of tumor cells to doxorubicin. PMID: 28035058 Among a group of tumor cells, there is correlation between activation of the MRTF-dependent transcription and activated FAK-dependent regulation of cell migration. PMID: 27708220 The identification of the miR-206/TWF1/MKL1-SRF/IL11 signaling pathway sheds lights on the understanding of breast cancer initiation and progression, unveils new therapeutic targets, and facilitates innovative drug development to control cancer and block metastasis PMID: 27435395 Herein, we propose a new ILK-MMP9-MRTF axis that appears to be critical for endothelial-mesenchymal transition differentiation of endothelial to cancer-associated fibroblasts -like cells. Thus, it might be an attractive target for cancer treatment PMID: 28893556 CytoD modified MKL1, a coactivator of serum response factor (SRF) regulating CTGF induction, and promoted its nuclear localization. PMID: 27721022 HOTAIR is regulated by the RhoC-MRTF-A-SRF signaling pathway in breast cancer cells. PMID: 28069441 TNF-alpha and LPS promoted the interaction between MKL1 and PCAF. PMID: 28571745 MRTF-A-miR-206-WDR1 form feedback loop to regulate breast cancer cell migration. PMID: 28822708 miR-93-5p regulates myocardin-like 1 and STAT3 to affect epithelial-mesenchymal transition controlling breast cancer cell migration PMID: 28499590 results highlight the critical role of the actin-regulated MRTF transcriptional pathway for bleb-associated invasive motility, such as during entosis. PMID: 28774893 transcriptional co-activator MRTF-A and actin polymerization regulated a subset of miRNAs in vascular smooth muscle. Identification of novel miRNAs regulated by actin/MRTF-A may provide further insight into the mechanisms underlying vascular disease states, such as aortic aneurysm, as well as novel ideas regarding therapeutic strategies PMID: 27939432 Data suggest 2 major isoforms of profilin (Pfn1 and Pfn2) are co-regulated by a common mechanism involving the action of MKL1 [megakaryoblastic leukemia (translocation) 1 protein] that is independent of its SRF- (serum-response factor)-related activity; cellular externalization of Pfn1, rather than transcription, is affected by the perturbations of MKL1; MKL1 can influence cell migration by modulating Pfn1 expression. PMID: 28546428 Study observed a marginally significant association between rs6001946 and the risk of schizophrenia. Results indicated that rs6001946 of the megakaryoblastic leukemia 1 gene is likely a risk factor for schizophrenia. PMID: 27507698 RBM15-MKL1 fusion is associated with acute megakaryoblastic leukemia in non-Down syndrome. PMID: 28063190 The authors show MRTF family proteins bind YAP via a conserved PPXY motif that interacts with the YAP WW domain. This interaction allows MRTF to recruit NcoA3 to the TEAD-YAP transcriptional complex and potentiate its transcriptional activity. PMID: 28028053 The MKL1 promotes ovarian cancer cell migration and invasion by epigenetically activating MMP2 transcription. PMID: 28385531 Data suggest an interplay between megakaryocytic leukemia 1 (MKL1) and ASH2 protein to promote tumor necrosis factor alpha (TNF-alpha) induced proinflammatory transcription in macrophages. PMID: 28218970 The results suggest that integrin-adhesion-induced MRTF-A-SRF activation and ISG15 expression constitute a newly discovered signaling circuit that promotes cell migration and invasion. PMID: 26872785 FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin. PMID: 26554816 Redox-sensitive regulation of MRTF-A phosphorylation via palladin in vascular smooth muscle cell differentiation marker gene expression. PMID: 27088725 Identification of SAP-dependent Mkl1 signaling as a previously unrecognized mediator of aggressive progression of mammary tumors locally relapsing after radiotherapy. PMID: 25999144 MRTF-A is a critical for epithelial to mesenchymal transition and can be stereoselectively inhibited by CCG-1423. PMID: 26295164 p300 and MRTF-A synergistically enhance the expression of migration-related genes in breast cancer cells. PMID: 26476216 Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G protein-coupled receptor- and RhoA-mediated transcriptional regulation and cell proliferation PMID: 26459764 Study found that MRTF-A expression was up-regulated in metastatic anaplastic thyroid cancer tissues and promoted metastasis-relevant traits in vitro. PMID: 25955685 Ddx19 is an RNA export factor required for nuclear import of the SRF coactivator MKL1 PMID: 25585691 AMPK and Akt activation are responsible for the CTRP6-mediated anti-fibrotic effect by targeting RhoA/MRTF-A pathway PMID: 25962701 MKL1 recruited ASH2, a component of the H3K4 methyltransferase complex, to activate MMP9 transcription. PMID: 25746000 MRTF-A and STAT3 synergistically recruited DNMT1 to hypermethylate the promoter of BRMS1 and affect the expression of BRMS1.MRTF-A and STAT3 promote breast cancer cell migration via hypermethylating BRSM1. PMID: 25854163 results revealed that genetic variants in MKL1 might confer risk to schizophrenia. PMID: 25380769 MKL1 deficiency results in actin cytoskeletal disruption in myeloid and lymphoid cell lineages. PMID: 26224645 These data support a central role of the SRF/MRTF pathway in the pathobiology of lung fibrosis. PMID: 25681733 The authors show that Photorhabdus luminescens PTC5 and PTC3 toxins stimulated gene transcription via myocardin-related transcription factor A (also called MAL) and AP1 in HeLa cells. PMID: 25338512 MRTF-A and p300 activated the transcription of VE-cadherin gene by enhancing acetylation of histones. PMID: 25746323 data thus provide important and novel insights into the roles of MRTF-A and STAT3 in regulating MDA-MB-231 cell migration. PMID: 25038455 Data indicate that arginyltransferase 1 (ATE1) function controls Myocardin-related transcription factor A (MRTF-A) activity. PMID: 25381249 Activation of the actin/megakaryoblastic leukemia 1 (MKL1) signaling pathway promotes the hormonal escape of estrogen-sensitive breast cancer cell lines. PMID: 24721635 TGFB1-mediated induction of the short MKL1 isoform initiates progression to later stages of differentiation towards a stationary myofibroblast. PMID: 24424023 We conclude that the -184C>T of MKL1 is an important susceptibility factor for CAD in the Han Chinese in Henan Province PMID: 24615024 This study highlights a crucial role for the transcriptional regulator Mkl1 and its SAP domain during breast cancer progression PMID: 24495796 The actin/MKL1 signalling pathway influences cell growth and gene expression through large-scale chromatin reorganization and histone post-translational modifications. PMID: 24762104 Data suggest that megakaryoblastic leukemia 1 (MKL1) and histone acetyltransferase p300 could augment the expression of catechol-O-methyltransferase (COMT), increase estrogen metabolism, and thus reduce MCF-7 cell proliferation stimulated by estrogen. PMID: 24096006 in both Drosophila and human cellular models that actin is the key target that must be regulated by MAL/SRF for invasive cell migration PMID: 24831700 results provided novel evidence supporting the metastasis-promoting functions of MRTF-A, and implied that MRTF-A might be a switch for the estrogen pathway to change its proliferation-promoting roles into migration-stimulating roles in breast cancer PMID: 24084383 Overexpression of SMYD3 promotes MRTF-A-mediated upregulation of MYL9 and migration of MCF-7 breast cancer cells PMID: 24189459

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.