Recombinant Human Myeloid Cell Surface Antigen Cd33 (CD33) Protein (His-SUMO&Myc)

Name: Recombinant Human Myeloid Cell Surface Antigen Cd33 (CD33) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-03470P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins, Recombinant cell therapy targets for car-t research

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Myeloid Cell Surface Antigen Cd33 (CD33) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P20138
Target Symbol	CD33
Synonyms	CD33; SIGLEC3; Myeloid cell surface antigen CD33; Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD antigen CD33
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Expression Range	48-259aa
Protein Length	Extracellular Domain
Mol. Weight	46.7 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK. These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules. One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K.
Subcellular Location	[Isoform CD33M]: Cell membrane; Single-pass type I membrane protein.; [Isoform CD33m]: Peroxisome.
Protein Families	Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Database References	HGNC: 1659 OMIM: 159590 KEGG: hsa:945 STRING: 9606.ENSP00000262262 UniGene: PMID: 28477215 Genetic variations in CD33 influence atrophy of specific Alzheimer's Disease-related brain structures; specifically the hippocampus and parahippocampal gyrus. PMID: 26803496 The mean percentage of CD33-positivity of the myeloblast population was 80.5% in acute myeloid leukemia (AML), 81.8% in chronic myelomonocytic leukemia (CMML) and 75% in myelodysplastic syndromes (MDS). PMID: 26726757 The 161533 TriKE induced superior NK cell cytotoxicity, degranulation, and cytokine production against CD33(+) HL-60 targets and increased NK survival and proliferation. PMID: 26847056 High efficacy of CD33/CD3 TandAbs in various preclinical models of human AML. PMID: 27189165 The use of CD33(+)CD11b(+)HLA-DR(-) cells as a predictive and prognostic biomarker. PMID: 27178742 Data suggest that two SNPs in CD33 (rs3865444A, rs12459419T) that are protective of Alzheimer disease result in splice variants (CD33M, CD33m); CD33M localizes predominantly at cell surface in macrophage cell line; CD33m is primary intracellular form in neutrophils and a microglia cell line; intracellular CD33m accumulates in peroxisomes; activation of macrophages/neutrophils does not mobilize CD33m to cell surface. PMID: 28747436 In cutaneous diffuse large b-cell lymphoma, a considerable proportion of CD33(+) myeloid-derived suppressor cells (MDSCs) with PD-L1 coexpression was admixed. Tumor cells expressed CD33 to variable degrees (2% to 60%). We propose that PD-L1(+) tumor cells and PD-L1(+) MDSCs shield the tumor against PD-1(+) tumor-infiltrating lymphocytes, consequently leading to inhibition and diminution of tumor-infiltrating lymphocytes. PMID: 28504999 patients with the CC genotype for rs12459419 have a substantial response to Gemtuzumab Ozogamicin, making this a potential biomarker for the selection of patients with a likelihood of significant response to Gemtuzumab Ozogamicin. PMID: 28644774 CD33-expressing microglia play a central role in the development of leukoencephalopathy in Nasu-Hakola disease brains PMID: 26087043 There is substantial evidence that rs3865444 (CD33) function is related to AD pathways and pathology, but our data does not support an interaction with rs670139 (MS4A4E) that impacts AD risk. PMID: 26449541 this study investigated the contribution of the immunoregulatory receptor CD33 to a uniquely human postreproductive disease, Alzheimer's dementia. PMID: 26621708 the CD33 rs3865444 polymorphism is associated with Alzheimer's disease susceptibility in Chinese, European, and North American populations. PMID: 25186233 CD33 and MS4A cluster variants are associated with LOAD susceptibility in East Asian populations. PMID: 26455864 Among those with one or more APOE epsilon4 alleles, having one or more copies of the CD33 C (risk) allele may further increase the risk of cognitive decline PMID: 26102276 decreased TREM2 expression with CD33 suppression and elevated cortical TREM2 mRNA expression with amyloid pathology PMID: 26414614 we propose a model wherein a modest effect on RNA splicing is sufficient to mediate the CD33 association with AD risk and suggest the potential for an anti-CD33 antibody as an AD-relevant pharmacologic agent. PMID: 25762156 Its single-nucleotide polymorphism rs3865444 in the CD33 gene as being associated with the reduced risk of developing Alzheimer's disease. PMID: 25448602 87.8% of AMLs express CD33. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression. PMID: 24927407 This study showed that CD13 and CD33 expression associated with poor prognosis in patients with MM implicating the need of analysis of these markers in MM diagnosis. PMID: 24991573 Lectin galactoside-binding soluble 3 binding protein (LGALS3BP) is a tumor-associated immunomodulatory ligand for CD33-related Siglecs. PMID: 25320078 The rs3865444(C) risk allele is strongly associated with greater expression of CD33 exon 2 and increased Alzheimer's disease susceptibility. [Meta-analysis] PMID: 24381305 Dasatinib enhances migration of monocyte-derived dendritic cells by reducing phosphorylation of inhibitory immune receptors Siglec-9 and Siglec-3. PMID: 24882272 This review discusses the recent epidemiological findings of CD33 that relate to Alzheimer's disease and the pathogenic roles played by CD33 in this disease. PMID: 23982747 Case Report: indolent T-lymphoblastic proliferation with disseminated multinodal involvement with partial CD33 expression on T cells. PMID: 24618611 Data suggest that the CD16xCD33 bispecific killer cell engager (BiKE) functions against both CD33(+) myelodysplastic syndromes (MDS) and myeloid-derived suppressor cells (MDSCs) targets and may be therapeutically beneficial for MDS patients. PMID: 24652987 Results indicate that anti-CD33 chimeric receptors strongly enhance anti-leukemic cytokine-induced killer cell functions. PMID: 20713459 these results suggest a novel model wherein single nucleotide polymorphism-modulated RNA splicing modulates CD33 function and, thereby, Alzheimer disease risk. PMID: 23946390 Our data suggest that genetic variations in CD33 could impact clinical outcome of GO-based therapy in pediatric acute myeloid leukemia . PMID: 23444229 This study showed that the rs3865444(C) risk allele was associated with greater cell surface expression of CD33 in the monocytes (t50 = 10.06, P(joint) = 1.3 x 10(-13)) of young and older individuals. PMID: 23708142 The minor allele of the CD33 SNP rs3865444, which confers protection against Alzheimer disease, was associated with reductions in both CD33 expression and insoluble amyloid beta 42 (Abeta42) levels in AD brain. PMID: 23623698 results support the view that single-nucleotide polymorphisms in GOLPH2 and in near gene 5' region of CD33 are significantly associated with sporadic Alzheimer's disease in the north Chinese Han population. PMID: 22167654 CD33 is expressed abundantly on immature CD34(+)/CD38(-) stem cells and may serve as a stem cell target in chronic myeloid leukemia. PMID: 21993666 data revealed the allele (T) of the rs3865444 polymorphism of the CD33 gene and the allele (C) of the rs610932 polymorphism of the MS4A6A gene may contribute to Alzheimer's disease risk in the Chinese Han population PMID: 22382309 Studies indicate that CD33 is expressed on hepatocytes, which makes them susceptible for targeted CD33 chemotherapy. PMID: 21329979 expression and localization of the two CD33 isoforms on several hematopoietic cell lines PMID: 21278227 found independent evidence for association for Alzheimer's disease susceptibility loci at EPHA1, CD33 and CD2AP PMID: 21460840 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease. PMID: 21460841 Specific induction of CD33 expression by E2A-HLF is associated with acute Lymphoblastic Leukemia. PMID: 20147975 Regulation of myeloid cell proliferation and survival by p75/AIRM1 and CD33 surface receptors. PMID: 11774609 Sites of serine/threonine phosphorylation by protein kinase C and the effect on its lectin activity PMID: 11964282 effectiveness of in vivo ablation of CD33+ cells to treat patients with aacaute myeloid leukemia. PMID: 11970770 review of structure, function, expression and clinical application PMID: 12144127 Expression of CD33 on CD4(+)CD56(+) lineage-negative cells should not exclude the diagnosis of plasmacytoid dendritic cell leukemia. PMID: 15388576 Amount of internalization of CD33 following antibody binding for gemtuzumab ozogamicin induced cytotoxicity suggest novel therapeutic approaches for improvement of clinical outcome of leukemia patients. PMID: 15454492 incubation of leukemia cells with anti-CD33 mAb and anticancer agents leads to additive antiproliferative effects and enhanced cytotoxicity. PMID: 15676214 Expression is rarely decreased in association with chromic myelogenous leukemia. PMID: 17662271 The results demonstrate that phosphorylation-dependent ubiquitylation of the immunoreceptor tyrosine-based inhibitory motif (ITIM) of CD33 regulates cell surface expression and internalization of this immunoreceptor. PMID: 18062779 CD13 was expressed in 73% of acute myeloid leukemia patients, CD15 was expressed in 43% of patients, CD33 was expressed in 64% of patients, and CD34 was expressed in 66% of patients. PMID: 18085638 The species-specific differences in the expression expression of Siglecs in SIV infection was studied. PMID: 18331725

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.