Recombinant Human Myeloid Cell Surface Antigen Cd33 (CD33) Protein (Fc-Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05580P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC 50 of human CD33 protein is 4.289- 5.312 ng/ml. Biological Activity Assay
The purity of Human CD33 was greater than 90% as determined by SEC-HPLC
Recombinant Human Myeloid Cell Surface Antigen Cd33 (CD33) Protein (Fc-Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05580P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Back to school. back to lab. ready for results. - advance your research with beta lifescience, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins, In-stock recombinant proteins, Recombinant cell therapy targets for car-t research
Regular price
$40700
$407.00
Sale price$24000
$240.00Save $167
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Myeloid Cell Surface Antigen Cd33 (CD33) Protein (Fc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by HPLC. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC 50 of human CD33 protein is 4.289- 5.312 ng/ml. |
| Uniprotkb | P20138 |
| Target Symbol | CD33 |
| Synonyms | CD33; SIGLEC3; Myeloid cell surface antigen CD33; Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD antigen CD33 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-FC-Myc |
| Target Protein Sequence | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH |
| Expression Range | 18-259aa |
| Protein Length | Partial |
| Mol. Weight | 56.9 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK. These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules. One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K. |
| Subcellular Location | [Isoform CD33M]: Cell membrane; Single-pass type I membrane protein.; [Isoform CD33m]: Peroxisome. |
| Protein Families | Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family |
| Database References | HGNC: 1659 OMIM: 159590 KEGG: hsa:945 STRING: 9606.ENSP00000262262 UniGene: PMID: 28477215 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
