Recombinant Human Myeloblastin (PRTN3) Protein (His&Myc)

Name: Recombinant Human Myeloblastin (PRTN3) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-11093P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Myeloblastin (PRTN3) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P24158
Target Symbol	PRTN3
Synonyms	ACPA; AGP 7; AGP7; AGP7 serine proteinase; Azurophil Granule Protein 7; C ANCA; C ANCA antigen; C-ANCA antigen; CANCA; EC 3.4.21.76; Leukocyte proteinase 3; MBN; MBT; MBT WEGENER AUTOANTIGEN; Myeloblastin; Neutrophil proteinase 4; NP 4 ; NP-4; NP4; P29; PR 3; PR-3; PR3; Proteinase 3; Proteinase3; PRTN 3; Prtn3; PRTN3_HUMAN; Serine proteinase neutrophil Wegener granulomatosis autoantigen; Serine proteinase; neutrophil; Wegener autoantigen; Wegener granulomatosis autoantigen
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR
Expression Range	28-248aa
Protein Length	Full Length of Mature Protein
Mol. Weight	31.7 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro). By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell barrier function and thus vascular integrity during neutrophil transendothelial migration. May play a role in neutrophil transendothelial migration, probably when associated with CD177.
Subcellular Location	Cytoplasmic granule. Secreted. Cell membrane; Peripheral membrane protein; Extracellular side. Membrane raft; Peripheral membrane protein; Extracellular side.
Protein Families	Peptidase S1 family, Elastase subfamily
Database References	HGNC: 9495 OMIM: 177020 KEGG: hsa:5657 STRING: 9606.ENSP00000234347 UniGene: PMID: 30236095 Characterization of the CD177 interaction with the ANCA antigen proteinase 3 responsible for autoimmune diseases has been reported. PMID: 28240246 Our results demonstrate that in the early stage of sepsis, JMJD3 contributes to high levels of neutrophil mPR3 expression and thereby to the production of the inflammatory cytokine IL-1beta PMID: 29621735 A few peptides bound to proteinase 3 (PR3) hydrophobic pockets and inhibited PR3 binding to lipids, while the (KFF)3K d-peptide inshowed a significant affinity for the lipids. PMID: 29132840 Studies indicate that the premature activation of proteinase 3 (PR3) would seriously harm the cell by its protease activity. PMID: 27559009 this study shows that transgenic mice expressing human Proteinase 3 exhibit sustained neutrophil-associated peritonitis PMID: 29079698 unique structural and functional characteristics of PR3 might be key contributors to the systemic inflammation and to the immune dysregulation observed in granulomatosis with polyangiitis. PMID: 28546501 Our findings demonstrate how RAGE-PR3 interactions between human prostate cancer cells and the bone marrow microenvironment mediate bone metastasis during prostate cancer progression PMID: 28428279 PRTN3 variants are associated with ANCA-associated vasculitis risk. PMID: 28029757 Clinical manifestations varied ANCA-associated vasculitis categories, and neither MPO-ANCA nor PR3-ANCA significantly affected relapse of AAV. PMID: 28339364 Changes in the DNA methylation status of the PRTN3 promoter may predict the likelihood of stable remission and explain autoantigen gene regulation PMID: 27821628 Study shows that MPO and PRTN3 in neutrophils of Anti-neutrophil cytoplasmic autoantibody (ANCA)-associated vasculitis (AAV) patients with active disease have a distinct pattern of histone modifications, which implicates epigenetic mechanisms in regulating expression of autoantigen genes and suggests that the epigenome may be involved in AAV pathogenesis. PMID: 27752292 The levels of both NE and PR3 correlated with absolute neutrophil counts and are reduced in type 1 diabetes mellitus patients. PMID: 26939803 Report prognostic value of proteinase-3-antineutrophil cytoplasmic antibody in patients with idiopathic interstitial pneumonias. PMID: 26873743 Molecular simulations suggest that PR3 interacts with phosphatidylserine via a small number of amino acids, which engage in long lasting interactions with the lipid heads. As phosphatidylserine is a major component of microvesicles (MVs), this study also examined the consequences of this interaction on MV production and function. PMID: 26961880 miR-634 mimics induced a proinflammatory phenotype in monocyte-derived macrophages, with enhanced expression and release of ADAM17 and IL-6 in Proteinase-3 ANCA-Associated Vasculitis PMID: 25788529 The PR3-induced microenvironment facilitated recruitment of inflammatory cells, such as macrophages, plasmacytoid DCs (pDCs), and neutrophils, which were observed in close proximity within granulomatous lesions in the lungs of GPA patients. PMID: 26436651 ACPA negative rheumatoid arthritis shares the genetic susceptibility loci with ACPA positive disease. PMID: 25927497 Data suggest that targeting proteinase-3 (PR3) specific effector memory cells, to prevent relapse, and instituting anti IL-17 therapy, or modulating Tregs could be newer forms of therapy for granulomatosis with polyangiitis (GPA). PMID: 25461407 Anti-PR3 autoantibodies not detected in sera of patients with pulmonary tuberculosis. PMID: 24719228 these results highlight a potentially important role for proteinase 3 in emphysema. PMID: 25416382 The data shows that the neutrophil protease PR3 is a direct modulator of human platelets and causes shape change through activation of the Rho/Rho kinase and Ca(2+) signaling pathways. PMID: 24993595 These in vivo data provide, for the first time, compelling evidence of the collateral involvement of cathepsin G, NE, and proteinase 3 in cigarette smoke-induced tissue damage and emphysema PMID: 24929239 Proteinase 3-mediated caspase-3 activation controls neutrophil spontaneous death PMID: 25180606 Elevated levels of GCF proteinase 3 in CP, G-AgP, and gingivitis might suggest that proteinase 3 plays a role during inflammatory periodontal events in host response. PMID: 24949444 Circulating protein levels and enzymatic activity of PRTN3 are markedly elevated in patients with type 1 diabetes mellitus, and are correlated with increased autoantibodies against beta-cell antigens. PMID: 25092677 It reports the synthesis and enzymatic studies on a new proteinase 3 intermolecular quenched substrate with enhanced selectivity over neutrophil elastase. PMID: 23911525 The presence of ANCA in the bile of patients with primary sclerosing cholangitis (PSC) is a novel finding and highly suggestive of PSC. Biliary IgG ANCA correlates with the severity of bile duct strictures. PMID: 23957616 Lateral flow assay for the determination of IgG-autoantibodies to Pr3. PMID: 24291125 Proteinase 3-anti-neutrophil cytoplasmic antibody (ANCA) serum and cerebrospinal fluid (CSF) levels are used as a marker for the more severe form of hypertrophic pachymeningitis. PMID: 24271323 Neutrophil elastase and proteinase-3 trigger G protein-biased signaling through proteinase-activated receptor-1 (PAR1). PMID: 24052258 Proteinase 3 may play a greater role in alpha-1-antitrypsin deficiency and COPD PMID: 22936713 Changes in proteinase 3 anti-neutrophil cytoplasm autoantibody levels in early systemic granulomatosis with polyangiitis (Wegener's) may reflect treatment rather than disease activity. PMID: 23380137 Neutrophil proteinase 3 plays a significant role in promoting vascular integrity by signaling through endothelial cell PAR-2. PMID: 23202369 PAR signaling and serine protease-induced alterations in endothelial function modulate glomerular inflammation via parallel but independent pathways PMID: 22952809 Some anti-PR3 responses are highly variable across donors. PMID: 22791638 Membrane PR3 expressed on apoptotic neutrophils might amplify inflammation by affecting the anti-inflammatory "reprogramming" of macrophages. PMID: 22844112 Early plasma exchange in addition to cyclophosphamide/glucocorticoid treatment improves outcome in PR3-ANCA-positive renal vasculitis. PMID: 22510451 PR3 expression and activity are significantly increased on transmigrating neutrophils; PR3 and NB1/CD177 interactions may play a role in aiding neutrophil transmigration. PMID: 22266279 Proteinase 3 carries small unusual carbohydrates and associates with alphalpha-defensins. PMID: 22138257 the dual functions (activation/termination) of PR3 in IL-33 biological activity. PMID: 22270365 the activity of myeloblastin was significantly altered in the lung adenocarcinoma biopsies harboring a KRAS gene mutation. PMID: 22210048 membrane-bound PR3 acts as a non-opsonic phagocytosis receptor for bacteria probably by activating PAR2 in neutrophils PMID: 21700341 Suggest that in Wegener's granulomatosis and Churg-Strauss syndrome the cytokine response of the total CD4+ T-cell population and PR3-specific cells is influenced by the underlying disorder. PMID: 21470489 neutrophil elastase (NE) and proteinase-3 are capable of almost complete degradation of hemoglobin in vitro PMID: 21193404 pivotal role of the NB1-Mac-1 receptor interaction for PR3-ANCA-mediated neutrophil activation PMID: 21193407 healthy individuals have masked circulating, noncross-reactive, antigen-specific natural autoantibodies against MPO, PR3, and GBM in their serum and IgG fraction PMID: 20592714 The trafficking of precursor NE (proNE) and precursor PR3 (proPR3), was compared. PMID: 20828556 cANCAs from Wegener's granulomatosis patients at least in part recognize similar surface structures as do mouse monoclonal antibodies and compete with the binding of alpha1-protease inhibitor to PR3. PMID: 20530264 The increased membrane expression of PR3 found in ANCA-associated systemic vasculitis is not linked directly to circulating PR3 or PR3 gene transcription, but is dependent upon CD177 expression and correlated with the transcription of the CD177 gene. PMID: 20491791

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.