Recombinant Human Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His)

Name: Recombinant Human Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11212P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q16653
Target Symbol	MOG
Synonyms	BTN6; BTNL11; MGC26137; MOG alpha 5; MOG alpha 6; MOG AluA; MOG AluB; MOG; MOG Ig AluB; MOG_HUMAN; MOGIG2; Myelin oligodendrocyte glycoprotein; Myelin-oligodendrocyte glycoprotein; NRCLP7
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His
Target Protein Sequence	GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Expression Range	30-154aa
Protein Length	Full Length of Mature Protein
Mol. Weight	17.9 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.; (Microbial infection) Acts as a receptor for rubella virus.
Subcellular Location	[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 5]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 6]: Cell membrane; Single-pass type I membrane protein.; [Isoform 7]: Cell membrane; Single-pass type I membrane protein.; [Isoform 8]: Cell membrane; Single-pass type I membrane protein.; [Isoform 9]: Cell membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, BTN/MOG family
Database References	HGNC: 7197 OMIM: 159465 KEGG: hsa:4340 STRING: 9606.ENSP00000366095 UniGene: PMID: 26498263 Molecular Dynamics (MD) simulations were used to explore the interactions of MOG35-55 at the receptor level. PMID: 27388119 Adoptive transfer of serum from anti-MOG Ab mice or of purified anti-MOG Ab 8.18C5 into naive 2D2 recipients triggered activation and expansion of T cells followed by severe and robust experimental autoimmune encephalomyelitis, suggesting that the mechanism of anti-MOG Ab-mediated opsonization of auto-antigen may indeed contribute to initiation and propagation of CNS demyelinating disease. PMID: 27022743 Retinal nerve fiber layer may be better preserved in MOG-IgG versus AQP4-IgG optic neuritis. PMID: 28125740 Data show that aquaporin-4 (AQP4) and myelin-oligodendrocyte glycoprotein (MOG) autoantibodies double positive neuromyelitis optica spectrum disorder (NMOSD) patients had a multiphase disease course with a high annual relapse rate. PMID: 26920678 MOG antibody associated optic neuritis tends to involve the anterior optic pathway. PMID: 26163068 This study demonstrated that increased expression of mRNA of OLIG1 in ventral prefrontal white matter in major depressive disorder. PMID: 25930075 In patients with idiopathic optic neuritis, 27.6% (8/29) were positive for MOG antibodies. Three of the eight MOG-positive patients showed significantly high CSF levels of myelin basic protein. Five had optic pain and three had prodromal infection. PMID: 25838512 Immune modulation by a tolerogenic myelin oligodendrocyte glycoprotein (MOG)10-60 containing fusion protein in the marmoset experimental autoimmune encephalomyelitis model. PMID: 25393803 These data demonstrate a new role for myelin glycosylation in the control of immune homeostasis in the healthy human brain through the MOG-DC-SIGN homeostatic regulatory axis, which is comprised by inflammatory insults that affect glycosylation. PMID: 24935259 findings suggest that immune reactions toward MOG and in particular MOG-specific antibodies may play a functional role in multiple sclerosis PMID: 22494461 Patients with neuromyelitis optica spectrum disorders with MOG antibodies have distinct clinical features, fewer attacks, and better recovery than patients with AQP4 antibodies or patients seronegative for both antibodies. PMID: 24415568 Bipolar I disorder and schizophrenia share a number of common genetic risk loci and susceptibility genes including the genes coding for myelin oligodendrocytes glycoprotein (MOG). PMID: 23032943 We could show for the first time that a subset of aquaporin 4-IgG seronegative patients with neuromyelitis optica exhibit a MOG-IgG mediated immune response PMID: 22204662 This study provides valuable information about requirements of anti-myelin oligodendrocyte glycoprotein reactivity for being regarded as a prognostic biomarker in a subtype of MS. PMID: 22093619 The authors found that the human myelin oligodendrocyte glycoprotein (MOG) specifically bound to the E1 envelope glycoprotein of rubella virus, and an antibody against MOG could block rubella virus infection. PMID: 21880773 A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy. PMID: 21907016 The persistence or disappearance of antibodies to MOG may have prognostic relevance for acute childhood demyelination PMID: 21795651 Conformational structure of the MOG-derived peptide 101-108 in solution. PMID: 20549678 A mutated MOG peptide [MOG97-109] enables detection of MOG97-109-reactive T cells in multiple sclerosis patients bearing the HLA-DRB1*0401 allele. PMID: 21653833 Report provides evidence that the humoral immune response against MOG in children is specific for demyelinating inflammatory CNS disorders. PMID: 21177754 Persistence of MOG antibodies despite viral clearance in a high percentage of HIV-1 associated neurocognitive disorder (HAND) patients suggests ongoing neuroinflammation, possibly preventing recovery from HAND. PMID: 21083890 cell surface-expressed native myelin oligodendrocyte glycoprotein nor linear epitopes have a predictive or discriminative role during the preclinical disease phase for developing clinically isolated syndrome or multiple sclerosis later in life PMID: 20685767 The results of this study have observed that changes in splicing, but not expression levels, are associated with common genetic variation in the MOG gene PMID: 20800907 Our study provides first evidence that the MOG G511C (Val142Leu) polymorphism might be associated with structural changes in the total white matter volumes of OCD patients. PMID: 20452030 identification of T cell epitopes that are encephalitogenic and presented by B cells PMID: 11739534 The B cell and T cell epitopes have been identified in rat MOG-immunized marmosets, and these sequences are observed to map primarily onto accessible regions in the model, which may explain their ability to generate potent antibody responses. PMID: 11895369 A T cell reactivity pattern analysis of multiple sclerosis patients at the onset of relapse or progression shows that there is a highly immunogenic epitope for CD4+ T cells within the transmembrane/intracellular part of MOG comprising amino acids 146-154. PMID: 12077287 MOG-specific antibody is critical to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis PMID: 12115610 polymorphisms do not provide evidence to support a significant role for MOG in multiple sclerosis susceptibility. PMID: 12149493 a substantial proportion of MOG-reactive T cells from some subjects have been activated in vivo without resulting in clinical disease PMID: 12482392 Human MOG is immunogenic and induces experimental autoimmune encephalomyelitis in C57BL/6 mice via an encephalitogenic B cell response to epitopes on human MOG protein that most likely cross-react with mouse determinants. PMID: 12817031 Demonstration of molecular mimicry between MOG and butyrophilin suggests that exposure to this common dietary antigen may influence the composition and function of the MOG-specific autoimmune repertoire during the course of multiple sclerosis. PMID: 14688379 No significant evidence for biased transmission of alleles at the (CA)n (chi2=2.430, 6 df, P=0.876) (TAAA)n (chi2=3.550, 5 df, P=0.616), C1334T (chi2=0.040, 1 df, P=0.841) and C10991T (chi2=0.154,polymorphisms in patients with schizophrenia was seen. PMID: 15660663 In human brain the splice variants of MOG appear at a late stage compared to the major isoform, coincidental with myelination and myelin maturation, unlike other myelin proteins. PMID: 16903876 pathogenic antibody response to native MOG in a subgroup of multiple sclerosis patients PMID: 17142321 This study represents the first evidence of alternative translation products from the MOG gene. To date, it is believed that alternative splicing of MOG is limited to primates. PMID: 17402967 results indicate that variation within the MOG gene is not an important independent determinant of multiple sclerosis -inherited risk in the Sardinian population PMID: 17509152 MOG may be a target of Hoxd1 PMID: 17554625 Our findings highlight myelin oligodendrocyte glycoprotein splicing as a factor that could be critical to the phenotypic expression of multiple sclerosis. PMID: 17573820 The associations observed in Japanese and French patients, the linkage studies and the present work speak in favor of the existence of a susceptibility gene for autism in the NF1 locus. PMID: 17897745 A sequence variation in the MOG gene is involved in multiple sclerosis susceptibility in Italy. PMID: 17928868 although individuals with anti-myelin oligodendrocyte glycoprotein (MOG) antibodies have an increased risk of developing multiple sclerosis, this association may at least in part reflect cross-reactivity between MOG and Epstein-Barr nuclear antigen PMID: 18753473 genetic polymorphism is associated with autism in Sardinian children PMID: 19167444 B cell autoimmunity to this MOG is therefore most common in patients with a very early onset of MS PMID: 19687098

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.