Recombinant Human Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11212P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11212P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q16653 |
| Target Symbol | MOG |
| Synonyms | BTN6; BTNL11; MGC26137; MOG alpha 5; MOG alpha 6; MOG AluA; MOG AluB; MOG; MOG Ig AluB; MOG_HUMAN; MOGIG2; Myelin oligodendrocyte glycoprotein; Myelin-oligodendrocyte glycoprotein; NRCLP7 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His |
| Target Protein Sequence | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG |
| Expression Range | 30-154aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 17.9 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.; (Microbial infection) Acts as a receptor for rubella virus. |
| Subcellular Location | [Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 5]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 6]: Cell membrane; Single-pass type I membrane protein.; [Isoform 7]: Cell membrane; Single-pass type I membrane protein.; [Isoform 8]: Cell membrane; Single-pass type I membrane protein.; [Isoform 9]: Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, BTN/MOG family |
| Database References | HGNC: 7197 OMIM: 159465 KEGG: hsa:4340 STRING: 9606.ENSP00000366095 UniGene: PMID: 26498263 |
